KEGG   Burkholderia vietnamiensis: Bcep1808_4474Help
Entry
Bcep1808_4474     CDS       T00493                                 

Definition
hypothetical protein
Organism
bvi  Burkholderia vietnamiensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:1313743..1315935
Genome map
AA seq 730 aa AA seqDB search
MAVCAALAASAAPAENVLPATTSWIGNTFGYGDGSWTQIDIRAIAVTPDGKVYTNAPWDE
SGAEASVYQDGKMLGFAGGTHGWGNLGGSAVAVNGKYAYVAIGVGNERGHLQSPGIWPDK
GKQWFGISRRTLGDMKQPAPFRAAPQVAPGGRADAGRARMAASFMVMNEVAAPARSEVGE
SKAEVGGLAADDKTLFATNPTHDEVDVYDADTMQKKATWSAHEPGRIALAGDGTLWLLTD
TITGPARLAHVRADGRKLDDAPALPEGTAAVDVAVDAKGRVLIADNGPRQQVLIFSKGGH
GYAPSGTLGERGGIFAGPVPGRPGPQRFNGLTGVGVDRAGNVYVSMNGIGPRHDTIGAGL
GAVLESYTPDGKLRWQVQGLLFVDGAWLDPARPNSVYTGNKRFELDLSKPPGQDWKYVGF
LSNRFKYPDDPVFHTDQYPGMPFARRLDGRTFLYLTDMYADHLKIYRFDAKRDGEVAIPS
GLIAGRARPVDKVPNKPPGGDWIWRDANGNGRLDADEFTINTTGKAKAGGWGWWVDTKGD
IWRTSDVRGIHRFAYGGVDKAGNPIYSYDKVTTYPMPQPFTQLRRALYEPQTDTLYVTGY
TADAPPQPGINKEVGRVLVRFDKWSSGSPVLRYQVALPWQLDAKPIFDLIGITVEGRYLF
TVEPVGKIHVYDKETGKEVGVMSPGAEVGRASGWVDVPFGISAFRRENGEYLVFVEEDAR
GKVLMYRWKP
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atggccgtatgcgcggcgctcgcggcgagcgccgccccggccgaaaacgtgttgcccgcg
accacgtcgtggatcggcaatacgttcggctatggcgacggcagctggacgcagatcgat
atccgcgcgatcgcggtcacgcccgacggcaaggtgtatacgaacgcgccgtgggacgag
agcggcgctgaagcgagcgtctatcaggacggcaagatgctcggcttcgccggcggcacg
catggctggggcaacctcggcggcagcgcggtcgcggtcaacggcaagtacgcgtacgtc
gcgatcggcgtcggcaacgagcgcggccatctgcagtcgcccggcatctggccggacaag
ggcaagcagtggttcggcatttcacggcgcacgctcggcgacatgaagcagccggcgccg
tttcgcgcggcgccgcaggtcgcgcccggcgggcgcgccgatgcgggccgcgcacggatg
gccgcgagcttcatggtgatgaacgaggtggcggcgccggcgcgctcggaggtgggcgag
tcgaaggccgaagtgggcggactcgccgcggacgacaagacgctgttcgcgacgaacccg
acgcacgacgaagtcgacgtgtacgacgccgacacgatgcagaagaaggccacctggagc
gcgcacgagccgggccgcatcgcgctggccggcgacggcacgttatggctgctgaccgac
acgatcaccggccccgcgcggctcgcgcacgtgcgtgccgacggccgcaagctcgacgac
gcgcccgcgctgcccgaaggcaccgcggcggtggacgtggcggtcgatgcgaaagggcgc
gtgctgatcgcggacaacggcccgcgccagcaggtgctgattttttcgaagggcggccac
ggctatgcgccgtccggcacgctcggcgagcgcggcggcatctttgccggcccggtgccg
gggcgtccggggccgcagcgcttcaacggcttgaccggtgtcggcgtcgatcgcgccggc
aacgtgtacgtgtcgatgaacggcatcgggccgcgccacgacacgatcggcgccgggctc
ggcgcggtgctcgaaagctacacgcccgacggcaagctgcgctggcaggtgcaggggctg
ctgttcgtcgacggcgcgtggctcgatcccgcgcggccgaacagcgtgtacacgggcaac
aagcgcttcgagctcgacctgtcgaagccgcctgggcaggactggaaatacgtcgggttc
ctgtccaaccgcttcaagtatccggacgacccggtattccacacggaccagtatccgggc
atgccgttcgcgcgccgcctcgacggccgcacgttcctgtacctgaccgacatgtacgcc
gatcacctgaagatctaccgcttcgacgccaagcgcgacggcgaggtcgcgattccgtcg
gggctgatcgcgggccgtgcgcggccggtcgacaaggtgccgaacaagccgccgggcggt
gactggatctggcgcgatgcgaacggcaacggccggctcgacgccgacgaattcacgatc
aacacgaccggcaaggcgaaggcgggcggctggggctggtgggtcgacacgaagggcgac
atctggcgcacgagcgacgtgcgcggcatccatcgcttcgcttacggcggcgtcgacaag
gccggcaacccgatctattcgtacgacaaggtcacgacctatccgatgccgcagccgttc
acgcagctgcgccgcgcgctctacgagccgcagaccgacacgctgtacgtgaccggctat
accgcggacgcgccgccgcaaccgggcatcaacaaggaggtcggccgcgtgctggtgcgc
ttcgacaaatggtcgagcggctcgccggtgctgcgctaccaggtcgcgttgccgtggcag
ctcgacgcgaagccgatcttcgatctgatcgggatcaccgtcgagggccgctacctcttc
acggtcgagccggtcgggaagatccacgtgtacgacaaggaaaccggcaaggaagtgggc
gtgatgagccccggtgcggaggtcggccgcgcgtcgggctgggtcgacgtgccgttcggc
atcagcgcgttccggcgcgagaacggcgaatacctggtgttcgtcgaggaagacgcgcgc
ggcaaggtgctgatgtaccgctggaaaccgtaa

DBGET integrated database retrieval system