KEGG   Burkholderia vietnamiensis: Bcep1808_4600Help
Entry
Bcep1808_4600     CDS       T00493                                 

Definition
LysR family transcriptional regulator
Organism
bvi  Burkholderia vietnamiensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(1427080..1428030)
Genome map
AA seq 316 aa AA seqDB search
MEDLDLNLVTALDALLGEASVTGAARRLGLSASAMSRTLARLRAATGDQLLVRAGRRLVP
TPHATALRERVHAVAREAQAVLRPAAADLDLATLSATFTLRAAASFMEMLGGPVVAAIGD
VAPGVRVRFVPRLARDPGPLRDGSVDLDIGKRGDDAPELHTRELFHDAHVAVARSGHPLF
AAARITPARYAACRHVIAAQLGDFGGPADDGERTAVAAHNVHVVVPGYPDAMRVAAGTDL
IALVPRSSLGNALTPGLADALGLRSFAIPVKLPEILISALWHPRMHGDPVHRRLRDVVID
VCTRAYPQSRAPRRPR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggaagacctcgatctgaacctcgtcaccgcgctcgacgcgctgctcggcgaagccagc
gtgaccggcgccgcgcgccggctgggcttaagcgcgtccgcgatgagccgcacgctcgcg
cgcttgcgcgcggccaccggcgaccagctgctcgtgcgcgccggacgccggctcgtgccg
acgccgcacgcgacggcgttgcgcgagcgcgtgcacgcggtcgcacgcgaagcgcaggcc
gtgctgcggccggcagcggccgacctcgacctcgcgacgctgtcggccaccttcacgctg
cgcgcggcggcgtcgttcatggagatgctgggcggcccggtcgtcgccgcgatcggcgac
gtcgcgcccggcgtgcgcgtgcgcttcgtgccgcggctcgcgcgcgaccccgggccgctg
cgcgacggctcggtcgatctcgacatcggcaagcgcggcgacgacgcgccggagctgcac
acgcgcgagctgtttcacgacgcgcacgtcgcggtggcgcgcagcggccacccgctgttc
gccgcggccagaatcacgccggcgcgctacgcggcctgccgccacgtgatcgcggcgcag
ctcggcgacttcggcggcccggccgacgacggcgagcgcacggcggtggccgcgcacaac
gtccacgtggtcgtgcccggctatccggatgcgatgcgcgtcgcggccggcaccgacctg
atcgcgctggtgccgcgctcgagcctcggcaacgcgctcacgccggggctcgcggatgcg
ctcgggctgcgcagcttcgcgatcccggtcaagttgcccgagatcctgatctcggcgctg
tggcacccgcgcatgcacggcgacccggtgcatcggcggctgcgcgacgtcgtcatcgac
gtctgcacgcgtgcgtatccgcaaagccgcgcgccgcgccgcccgcgctga

DBGET integrated database retrieval system