KEGG   Burkholderia vietnamiensis G4: Bcep1808_4603Help
Entry
Bcep1808_4603     CDS       T00493                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
bvi00010  Glycolysis / Gluconeogenesis
bvi00071  Fatty acid degradation
bvi00350  Tyrosine metabolism
bvi00625  Chloroalkane and chloroalkene degradation
bvi00626  Naphthalene degradation
bvi01100  Metabolic pathways
bvi01110  Biosynthesis of secondary metabolites
bvi01120  Microbial metabolism in diverse environments
bvi01130  Biosynthesis of antibiotics
bvi01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bvi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcep1808_4603
  Lipid metabolism
   00071 Fatty acid degradation
    Bcep1808_4603
  Amino acid metabolism
   00350 Tyrosine metabolism
    Bcep1808_4603
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Bcep1808_4603
   00626 Naphthalene degradation
    Bcep1808_4603
Enzymes [BR:bvi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Bcep1808_4603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: ABO57566
JGI: Bcen18084603
UniProt: A4JMR3
Position
2:1429320..1430477
Genome map
AA seq 385 aa AA seqDB search
MNPFQFRTVATQIVEFGAARRLGPLLRERFPSLVRLCVVTDAFLHRSGVLAPALESLAAH
GWQVSVIDDVIADPPEHVVLEATARAVAADAEIVLGLGGGSSMDVAKLIAVLAPGRQALA
DMYGVDKVATPRLPLVQMPTTAGTGSEVTAVSIVTVGEARKMGVVSPQLFADVAILDAEL
TLGLPRAATAATGIDAMVHAIEAYTSARLKNPVSDMLAVHALTLLSRNVLKACDDGHDRA
AREAMLVGAMFAGQAFANAPVAAVHALAYPIGGIFHVPHGLSNALVLPHVLRFNAAAAAP
LYAELAAIVAPSATGSDAARTQALIDEIDRLIVATGIPRTLREVGVGEADLPRMAADAML
QTRLLVNNPREVTEADALAIYRQAW
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgtttcaattccgtaccgtcgcgacgcagatcgtcgaattcggcgcagcacgc
cggctcggcccgctgttgcgcgaacgctttccgtcgctcgtgcggctgtgcgtcgtcacc
gacgcgttcctgcatcgcagcggcgtgctcgcgcccgcgctcgagagcctcgccgcgcac
ggctggcaggtgagcgtgatcgacgacgtcatcgccgatccgcccgagcacgtggtgctc
gaagcgaccgcgcgcgcggtggccgccgacgccgagatcgtgctcggcctcggcggcggc
tcgtcgatggacgtcgcgaagctgatcgccgtgctcgcgccgggccggcaggcgctggcc
gacatgtacggcgtcgacaaggtcgcgacgccgcggctgccgctcgtgcagatgccgacc
acggccggcaccggctcggaagtgacggccgtatcgatcgtcacggtcggcgaagcgcgc
aagatgggcgtggtgtcgccgcagctgttcgcggacgtcgcgatcctcgatgccgagctc
acgctcgggctgccgcgcgccgcgacggcagcgaccggcatcgacgcgatggtgcacgcg
atcgaagcctatacgtcggcgcggttgaagaacccggtgtcggacatgctggccgtgcac
gcgctgacgttgctgtcgcgcaatgtgctgaaggcatgcgacgacggccacgatcgcgcg
gcgcgcgaagcgatgctggtcggcgcgatgttcgcgggtcaggcgttcgcgaatgcgccg
gtggcggccgtgcatgcgctcgcttacccgatcggcggcattttccacgtgccgcatggc
ttgtcgaacgcgctcgtgctgccgcacgtgttgcgcttcaacgcggcggctgccgcgccg
ctgtacgcggagctcgcggcgatcgtcgcgccgtcggcgacgggcagcgacgcagcgagg
acgcaggcgctgatcgacgagatcgaccggctgatcgtcgcgaccggcattccgcgcacg
ctgcgcgaagtcggcgtcggcgaggccgacctgccgaggatggcggccgatgcgatgctg
cagacgcgtctgctcgtcaacaatccgcgcgaagtgaccgaagccgatgcgctcgcgatt
tatcggcaggcatggtga

DBGET integrated database retrieval system