KEGG   Burkholderia vietnamiensis G4: Bcep1808_4877Help
Entry
Bcep1808_4877     CDS       T00493                                 

Definition
(GenBank) Di-heme cytochrome c peroxidase
  KO
K00428  cytochrome c peroxidase [EC:1.11.1.5]
Organism
bvi  Burkholderia vietnamiensis G4
Brite
Enzymes [BR:bvi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Bcep1808_4877
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCP_MauG Cytochrom_C Cytochrome_CBB3 DUF1924
Motif
Other DBs
NCBI-ProteinID: ABO57834
JGI: Bcen18084877
UniProt: A4JNI1
Position
2:complement(1751900..1753318)
Genome map
AA seq 472 aa AA seqDB search
MTARPAYPSPDTPGAAAPRSPTRVLRRAAFVLAAAVLGYGAFAVAFPARTPAAIGEVVAN
WTGANPHPVVLQRPPVQPLSAVAQLGRALFFDPSLSASGKQSCASCHSPDRAYGPPNALD
VQPGGLTMTQQGYRPPPSLMYLYRQPNFSIGPDAGENDAAPSVAQQAASAAGVVKAQKVA
GTAAAPQLVPQGGMFWDGRADTLQQQAFGPLLNPVEMANASIDDVARKLAQSPHRARFEQ
LFGPRVFASSQLVVSEAMFAIARYQVEDRSFHPYDSKYDRWLEGRARLTQTELRGLRLFN
DPAKANCAGCHLSQPGKDGLPPMFTDYQYEALGVPRNRALAANRNPAFHDLGVCGPFRDD
LKDQTQYCGMFLTPTLRNAATRQVFFHNGVFHTLDQVMAFYNERSIAPQKFYPRGADGKV
DEYDDIPPQYRANVDVTDAPFDRKPGDRPAMTEQDIKDIEAFLGTLTDAPQK
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgacagctcgtcccgcgtacccgtcccccgacacgcccggcgccgccgcgccgcgctcc
cccacccgcgtgctgcgccgcgcggccttcgtgctcgccgcggccgtgctcggctacggc
gccttcgcggtcgcgtttccggcgcgcacgccggccgcgatcggcgaggtcgtcgcgaac
tggaccggcgccaatccgcatcccgtggtgctgcagcggccgcccgtgcagccgctgtcc
gcggtcgcgcagctcgggcgcgcgctgttcttcgatccgtcgctgtcggcatcgggcaag
cagtcgtgcgcgtcgtgccacagccccgaccgcgcttacgggccgccgaacgcgctcgac
gtgcagcccggcggcctcacgatgacgcagcagggctaccgcccgccgccgtcgctgatg
tatctgtaccggcagccgaacttcagcatcggccccgatgcgggcgaaaacgacgcggcg
ccgagcgtcgcgcagcaggcggcgtcggctgccggcgtggtcaaggcgcagaaggtggcc
ggcacggcggccgcgccgcaactcgtgccgcaaggcggcatgttctgggacggccgcgcc
gacacgctgcagcagcaggcgttcgggccgctgctgaacccggtcgagatggccaacgcg
agcatcgacgacgtcgcgcgcaagctcgcgcagtcgccgcatcgcgcgcgcttcgagcag
ttgttcggcccgcgcgtgttcgcgagctcgcagctcgtcgtatcggaggcgatgttcgcg
attgcgcgataccaggtcgaggaccggtcgttccatccgtacgacagcaagtacgatcgc
tggctggaaggccgcgcgcgcctcacgcagaccgagctgcgcgggctgcggctcttcaac
gatccggccaaggccaactgtgccggctgccatctgtcgcagccgggcaaggacggcctg
ccgccgatgttcaccgactaccagtacgaggcgctcggcgtgccgcgcaaccgcgcgctc
gcggcgaaccgcaacccggcgttccacgatctcggcgtgtgcgggccgttccgcgacgac
ctgaaggaccagacgcagtactgcgggatgttcctcacgccgacgctgcgcaacgcggcg
acgcgccaggtgttcttccacaacggcgtgttccacacgctcgatcaggtgatggcgttc
tacaacgagcgcagcatcgcgccgcagaagttctatccgcgcggcgcggacggcaaggtc
gacgaatacgacgacattccgccgcaataccgcgcgaacgtcgacgtgaccgatgcgccg
ttcgaccgcaagcccggcgaccggcccgcgatgaccgagcaggacatcaaggacatcgag
gcgttcctcggcacgctgaccgacgcgccgcagaagtag

DBGET integrated database retrieval system