KEGG   Burkholderia vietnamiensis: Bcep1808_4951Help
Entry
Bcep1808_4951     CDS       T00493                                 

Definition
TonB-dependent receptor
Orthology
K02014  
iron complex outermembrane recepter protein
Organism
bvi  Burkholderia vietnamiensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:1827494..1830319
Genome map
AA seq 941 aa AA seqDB search
MKQKVLALAIKRIVWAELALTAVLVPPAFAQSQPAPGAASIADAVANGAPVTVSQANGTA
GAVAATGAAASSAAAEATPAAPGANGQGKVAQIKRFEVTGSLIRQADKVGFNQVQTITSK
DIQNSGQTNVADYLRSTSANSASSWSEGSTNSFAPGGAGIALRGLSEKYTLVLIDGMRVS
PYAFAVNGSDQFFDLNTLPLNIIDRIEIVKTGAVSQYGSDAIAGVVNIITKKNFQGLELG
GSYGGATNGEGGQGTTQFSVLGGIGDLNADRFNVTAALSYYKSNGISIADRDTTQNQDFS
NFPGGLSNQNVSYWRNPTTGAKVPLSPCPNGGQAVPGTSVAQVNGPGTVCANNTAYASSL
SPWTERLSAKVHADFKISDAMQAFADLWESNNTTVTNNFVGRLGNSTQTYDPATGGLNPV
SNLVPGSNPYNPFGVPAKLVYSFPATQSVHTSSNFWRAATGVKGSFSTPRVGDWDWTASY
THSQNTVSNNYSNLINAAALENIVQNGVFNFANPSSTPNGLNGLYGSTSTQAITKLDAVD
ATLSTPNLFTLPTGNVGLGLGTQFTHQSQYIGTGADYANGTLVQPSLQSVNGERNVSAVY
YQIDIPILKNLTFSQSGRYDHYSDFGGAFSPRFALRFQPIRELTVYGSYNRGFRAPTLIE
NTSSRTYGAQGAVDSNDPNNPNAYNLVEEVQAGNSKLQPERTKNYNIGFQLSPTRNTDFG
FDWYKIHIDNVIGTEDIQTVVDQNDPSKVIRNPNGSIAYVVLPYMNLSSLDTDGFETTFR
QSVSTKIGTFTLSGDWAYVWHFKMPVGGETTDFAGNNGSLNEPFGGSFPRWKGNTSLNWN
YHNQWNATLTWMFTGPYSQAILSPGQYPNMQDSVASYSQFNLMVSYTGFKHWTIYAGIDN
IFNRAPPFDPVFMNASYQTGYDTSLYTYVGRFAQIGATYKF
NT seq 2826 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagaaagttttggcgttggccatcaagaggatagtctgggcggagctggcgttg
acggccgtgctggtgccgccggcgttcgcccagagccagccggcgccgggagccgcatcg
atcgcggatgcggtcgcgaacggcgcacccgtgaccgtttcgcaggcgaacggcacggcg
ggcgctgtcgctgccacgggtgccgcggcatcgagcgcggcagccgaggcgacgcctgcc
gcgcccggcgcgaacggacaaggcaaggtcgcgcagatcaagcgattcgaagtgacgggt
tcgctgatccggcaggccgacaaggtcggcttcaaccaggtgcagaccatcacgagcaag
gacatccagaacagcggtcagaccaacgtcgctgattacctgcgcagcacctcggcgaat
tcggcaagcagctggagcgaaggttcgacgaacagcttcgcgccgggcggcgcaggtatc
gcgctgcgcggcctcagcgagaaatacacgctggtgctgatcgacggcatgcgggtgtcg
ccgtatgcgttcgccgtgaacggcagcgatcagttcttcgacctgaatacgctgccgctc
aacatcatcgaccgcatcgaaatcgtcaagaccggcgcggtgtcccagtatggttcggac
gcaatcgcgggcgtggtgaacatcatcacgaagaaaaactttcagggtcttgaactgggc
ggcagctacggtggtgcgacaaacggtgaaggcggccagggcacgacgcagttcagcgtc
ctcggcggcatcggcgacctgaacgccgaccgcttcaacgtgacggcggcgctcagctac
tacaagtcgaacggcatctcgatcgccgatcgcgacacgacgcagaaccaggacttctcc
aatttcccgggcggcctgtcgaaccagaacgtgtcgtactggcgtaatccgaccaccggc
gcgaaggtgccgctgagcccgtgtccgaacggaggccaggccgtgccgggcacctccgtc
gcgcaggtcaacggtccgggcacggtctgcgcaaacaacaccgcgtacgcatcgtcgctg
tcgccgtggaccgaacgcctgagcgcgaaggtgcacgccgacttcaagatcagcgacgcg
atgcaggcgttcgccgatctctgggaaagcaacaatacgacggtcacgaacaatttcgtc
ggccgcctcggcaacagcacgcagacctacgatccggcgacgggcggtctcaacccggtt
tcgaacctcgtgccgggcagcaacccgtataacccgttcggcgtgccggccaagctggtc
tactcgttcccggccacgcagtccgtgcacacgagctcgaacttctggcgtgccgcgacg
ggtgtgaaaggctcgttcagcacgccgcgcgtgggcgactgggattggaccgcgtcctac
acgcattcgcagaacacggtgtcgaacaactattcgaacctgatcaacgcggccgcattg
gagaacatcgtccagaacggcgtgttcaacttcgccaatccgtcgtcgacaccgaacggg
ttgaacggcctttacggaagcacgtcgacgcaggccatcacgaagctcgacgctgtcgat
gcgacgctgtcgacgccgaacctgttcacgttgcccacgggtaacgtcggcctcggtctc
ggtacgcaattcacgcaccagagccagtacatcggtacaggcgcggactacgcgaacggc
acgctcgtccagccgtcgctgcaatcggtcaacggcgagcgcaacgtctcggcggtctac
taccagatcgacattcccatcctgaagaacctgacgttcagccagtcgggtcgctacgac
cactacagcgacttcggtggcgcgttctcgccgcgcttcgcgttgcgcttccagccgatc
cgcgagctgacggtgtacggttcctacaaccgcggcttccgcgcaccgacgctgatcgaa
aacacttcgtcgaggacctacggcgcgcagggcgcggtcgattcgaacgatcccaacaac
ccgaacgcatacaacctcgtcgaggaagtgcaggccggtaacagcaagctgcaaccggag
cgcaccaagaactacaacatcggcttccagctgtcgcccacccgcaataccgatttcggc
ttcgactggtacaagatccacatcgacaacgtgatcggcacggaagacatccagacggtg
gtcgaccagaacgatccgtcgaaggtgatccgtaacccgaacggctccatcgcgtatgtg
gtgctgccgtatatgaatctgtcgtcgctcgacaccgacggcttcgagacgaccttccgc
caatcggtgtcgaccaagatcggtacgttcacgctgtcgggtgactgggcctacgtatgg
cacttcaagatgccggtgggcggcgagacgaccgacttcgcgggcaacaacggttcgctg
aacgagccgttcggcggcagcttcccgcgctggaagggcaatacgagtctgaactggaac
taccacaaccaatggaatgcgacgttgacgtggatgttcacgggaccgtacagccaggcc
atcctgtcgccgggccagtatccgaacatgcaggacagcgtggcttcgtacagtcagttc
aacctgatggtcagctacaccggcttcaagcattggacgatctacgccggcatcgacaac
atcttcaatcgtgcgccgccgttcgatccggtctttatgaacgcgagctaccagacgggc
tatgacacgtcgctgtacacgtatgtcggtcgattcgcgcagatcggcgcgacctacaag
ttctga

DBGET integrated database retrieval system