KEGG   Burkholderia vietnamiensis G4: Bcep1808_4991Help
Entry
Bcep1808_4991     CDS       T00493                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
bvi00010  Glycolysis / Gluconeogenesis
bvi00071  Fatty acid degradation
bvi00350  Tyrosine metabolism
bvi00625  Chloroalkane and chloroalkene degradation
bvi00626  Naphthalene degradation
bvi01100  Metabolic pathways
bvi01110  Biosynthesis of secondary metabolites
bvi01120  Microbial metabolism in diverse environments
bvi01130  Biosynthesis of antibiotics
bvi01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bvi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcep1808_4991
  Lipid metabolism
   00071 Fatty acid degradation
    Bcep1808_4991
  Amino acid metabolism
   00350 Tyrosine metabolism
    Bcep1808_4991
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Bcep1808_4991
   00626 Naphthalene degradation
    Bcep1808_4991
Enzymes [BR:bvi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Bcep1808_4991
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C 2-Hacid_dh_C TrkA_N Methyltransf_25 NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: ABO57947
JGI: Bcen18084991
UniProt: A4JNU4
Position
2:complement(1876050..1877078)
Genome map
AA seq 342 aa AA seqDB search
MTQTMKAAVVHAFGEPLRIEEVPVPTPGPGQILVNIKATGVCHTDLHAADGDWPVKPTLP
FIPGHEGVGIVAAVGAGVTHVREGDRVGVPWLYTACGHCEYCHTGWETLCHGQENTGYSV
NGSYAEYVLADPNYVGHLPAQVAFDEIAPILCAGVTVYKGIRVTDTRPGQWLAISGIGGL
GHVAVQYARAMGLHVAAIDVSPAKLELARQLGAELTIDASVDDPAKVIQKEIGGAHGVLV
TAVSRSAFAQALGMVRRGGTVALNGLPPGDFPLPIFSTVLNGITVRGSIVGTRRDLQESL
DFAADGLVRAHIHRDRLGNINDIFSRLREGKIDGRIVLTDMQ
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgacccaaaccatgaaagcggccgtcgttcacgcattcggcgaaccgttgcgtatcgag
gaagtcccggtgccgacgcccggccccggccagattctcgtcaacatcaaggcgacgggc
gtctgccataccgacctgcacgccgccgacggcgactggcccgtgaagccgacgctgccg
ttcattcccggccacgaaggggtcggcatcgtcgcggcagtcggcgcgggcgtcacgcat
gtgcgcgaaggcgatcgcgtcggcgtgccgtggctgtacaccgcgtgcggccattgcgag
tactgccacacgggctgggaaacgctgtgccacggacaggagaacacgggctactcggtc
aacggtagctacgcggaatacgtgctggccgatccgaactacgtcggccatctgccggcg
caggtcgccttcgacgagatcgcgccgatcctgtgcgcgggcgtgacggtctacaagggc
attcgcgtcaccgatacgcgtccgggccagtggctcgcgatttccggcatcggcggcctc
ggccacgtggccgtgcagtacgcgcgggcgatgggcctgcacgtcgcggccatcgacgtg
tcgccggcgaagctcgagctcgcgcggcaactgggcgcggagctgacgatcgacgcatcg
gtcgacgatccggcgaaggtcatccagaaggaaatcggcggtgcgcacggcgtgctggtc
acggccgtatcgcgcagcgcgttcgcgcaggcgctcgggatggtccggcgcggcggcacg
gtcgcgctcaacggcttgccgccgggcgattttccgctgccgatcttctcgaccgtgctg
aacggcatcacggtgcgcggctcgatcgtcggcacgcgccgcgatctgcaggagtcgctc
gatttcgctgcggacggcctcgtgcgcgcgcatatccatcgcgaccggctcggcaacatc
aacgacatcttctcgcggttgcgcgaagggaagatcgacgggcgcatcgtgctgaccgac
atgcagtga

DBGET integrated database retrieval system