KEGG   Burkholderia vietnamiensis: Bcep1808_4997Help
Entry
Bcep1808_4997     CDS       T00493                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
bvi  Burkholderia vietnamiensis
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:bvi01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:bvi00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(1886927..1888513)
Genome map
AA seq 528 aa AA seqDB search
MSQYQDDIKAVAGLKENHGSAWNAINPEYAARMRAQNKFKTGLDIAKYTAKIMRADMAAY
DADPSKYTQSLGCWHGFIGQQKMISIKKHFNSTERRYLYLSGWMVAALRSEFGPLPDQSM
HEKTSVSALIRELYTFLRQADARELGGLFRELDAAKDAAAKAAIQQKIDNHVTHVVPIIA
DIDAGFGNAEATYLLAKQFIEAGACCIQIENQVSDEKQCGHQDGKVTVPHEDFLAKIRAI
RYAFLELGVDDGIIVARTDSLGAGLTKQIAVTNAPGDLGDQYNSFLDCEELSGDQLGNGD
VVIKRDGKLLRPKRLPSNLFQFRAGTGEARCVLDCITSLQNGADLLWIETEKPHIAQIAG
MVNEIRKVIPNAKLVYNNSPSFNWTLNFRQQVYDALKAEGKDVSAYDRAQLMSVEYDDTE
LAKLADDKIRTFQADASREAGIFHHLITLPTYHTAALSTDNLAKEYFGEQGMLGYVAGVQ
RKEIRQGIACVKHQNMSGSDIGDDHKEYFSGEAALKAAGKDNTMNQFS
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaatatcaagacgacatcaaggcagtggctggcttgaaggaaaaccacggcagc
gcgtggaatgccatcaatcccgagtatgccgctcgcatgcgcgcccagaacaagttcaag
acgggcctcgacatcgcgaagtacaccgcgaagatcatgcgcgccgacatggctgcgtac
gacgcggatccgtccaagtacacgcagtcgctcggttgctggcacggcttcatcggccag
cagaagatgatttccattaagaagcacttcaacagcaccgaacgccgctacctgtacctg
tcgggctggatggtcgctgcgctgcgctcggagttcggcccgctgccggaccagtcgatg
cacgaaaagacgtcggtcagcgcgctgatccgcgagctgtacacgttcctgcgccaggcc
gacgcccgtgagctcggcggcctgttccgcgagctggatgccgcgaaggacgccgctgcg
aaggccgcgatccagcaaaagatcgacaaccacgtgacgcacgtcgtgccgatcatcgcc
gacatcgacgccggtttcggcaacgctgaagcgacctatctgctggccaagcagttcatc
gaagcgggcgcatgctgcatccagatcgagaaccaggtgtcggacgagaagcagtgcggc
caccaggacggcaaggtcacggtgccgcacgaggacttcctcgcgaagatccgcgcgatc
cgctacgcattcctggagctgggcgtggatgacggcatcatcgtcgcgcgcaccgactcg
ctcggcgccggcctgaccaagcagatcgccgtgacgaacgcgccgggcgacctgggcgac
cagtacaactcgttcctcgactgcgaagaactgtcgggcgaccagctcggcaacggcgac
gtcgtgatcaagcgcgacggcaagctgctgcgtccgaagcgcttgccgagcaacctgttc
cagttccgcgccggcacgggtgaagcacgttgcgtgctggattgcatcacgtcgctgcag
aacggcgccgacctgctgtggatcgagaccgaaaagccgcacatcgcgcagatcgccggc
atggtcaacgaaatccgcaaggtgatcccgaacgcgaagctggtgtacaacaacagcccg
tcgttcaactggacgctgaacttccgtcagcaggtgtacgacgcgctgaaggccgaaggc
aaggacgtgtcggcatacgaccgtgcgcaactgatgagcgtcgaatacgacgacaccgaa
ctggcgaagctcgcggacgacaagatccgcacgttccaggccgatgcgtcgcgtgaagcc
ggcatcttccatcacctgatcacgctgccgacgtaccacacggccgcactgtcgaccgac
aacctcgcgaaggaatacttcggcgaacaaggcatgctcggctacgtggccggcgtgcag
cgcaaggaaatccgtcagggcatcgcgtgcgtgaagcaccagaacatgtcgggttcggac
atcggcgacgatcacaaggaatacttcagcggtgaagccgcgctgaaggcagcgggcaag
gacaacacgatgaaccagttctcgtaa

DBGET integrated database retrieval system