KEGG   Burkholderia vietnamiensis G4: Bcep1808_5307Help
Entry
Bcep1808_5307     CDS       T00493                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
bvi00240  Pyrimidine metabolism
bvi00250  Alanine, aspartate and glutamate metabolism
bvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bvi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Bcep1808_5307
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Bcep1808_5307
Enzymes [BR:bvi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Bcep1808_5307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace HTH_3 HTH_31
Motif
Other DBs
NCBI-ProteinID: ABO58255
JGI: Bcen18085307
UniProt: A4JPQ2
Position
2:2235101..2236396
Genome map
AA seq 431 aa AA seqDB search
MTVPQQAFLRDAMRRLNMTREAFASRIGVSRRALDTWLLPDDSQESRGMPEIVERFVSEI
VGRAGPDGEDYTQSVDKQGLAKQFLFEGKPQLISVDQFSRDSVEALFRVADVMQPIARRH
KISRVLEGAVLGNLFFEASTRTRVSFGAAFCRLGGSVCDTTGFTFSSMAKGESIYDTSRV
MAGYVDALVIRHPEKGSVAEFARATNLPVINGGDGPGEHPSQALLDLYTIQREFSRLGKI
VDGAHIALVGDLKYGRTVHSLVKLLALYRGLKFTLVSPPTLEMPAYIIDQITTNGHVIEQ
TNDLAAGLRGADVVYATRIQKERFTDESFEGYTPEFQINQALVDSVCKPDTLIMHPLPRD
SRPGANDLSIDLNRDPRLAIFRQTDNGIPVRMAIFAVLLGVENLVQHSMRDATWRPPAYL
GPEDAVFHGID
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttccccagcaagccttcctgcgcgacgcgatgcgccgcctcaacatgacgcgc
gaagcgttcgccagccgcatcggcgtgagccgccgtgcgctcgatacgtggctgctgccc
gacgattcgcaggaatcgcgcggcatgcccgagatcgtcgagcgcttcgtctcggaaatc
gtcgggcgggcgggcccggatggcgaagactatacgcaaagcgtagacaagcaaggcctc
gcgaagcagttcctgttcgaaggcaagccgcagttgatctcggtggaccaattctcgcgc
gactcggtggaagcgctgttccgcgtcgccgacgtgatgcagccgatcgcgcgccgccac
aagatttcgcgcgtgctcgagggcgcggtgctcggcaacctgttcttcgaagcgagcacc
cgcacgcgcgtgtcgttcggggcggcgttctgccggctcggcggctcggtgtgcgacacc
accggcttcacgttctcgtcgatggccaagggcgaatcgatctacgacacgagccgcgtg
atggccggctacgtcgacgccctcgtgatccgccacccggagaagggctcggtggccgaa
ttcgcgcgcgcgaccaacctgccggtgatcaacggcggcgacggccccggcgagcacccg
agccaggcgctgctcgacctttacacgatccagcgcgaattctcgcgcctgggcaagatc
gtcgacggcgcgcatatcgcgctcgtcggtgacctgaaatacggccgcaccgtccattcg
ctcgtcaagctgctggcgctgtatcgcgggctgaagttcacgctggtgtcgccgccgacg
ctcgagatgcccgcgtacatcatcgatcagatcacgacgaacggtcacgtgatcgagcag
accaacgacctcgcggccggactgcgcggcgcggacgtcgtctacgcgacgcggatccag
aaggagcgcttcaccgacgaatcgttcgaaggctacacgccggaattccagatcaaccag
gcgctcgtcgactccgtatgcaagcccgacacgctgatcatgcacccgctgccgcgcgac
agccggcccggcgcgaacgacctgtccatcgacctgaaccgcgatccgcgcctcgcaatc
ttccgccagaccgacaacggcatccccgtgcgaatggcgatcttcgcggtgctgctcggc
gtcgagaatctggttcagcactcgatgcgcgacgcgacgtggcgcccgcctgcgtatctc
gggccggaggacgcggtgttccacgggatcgattga

DBGET integrated database retrieval system