KEGG   Burkholderia vietnamiensis G4: Bcep1808_5385Help
Entry
Bcep1808_5385     CDS       T00493                                 

Definition
(RefSeq) acetaldehyde dehydrogenase (EC:1.2.1.10)
  KO
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:bvi00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Bcep1808_5385
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bcep1808_5385
   00650 Butanoate metabolism
    Bcep1808_5385
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Bcep1808_5385
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bcep1808_5385
   00622 Xylene degradation
    Bcep1808_5385
   00621 Dioxin degradation
    Bcep1808_5385
Enzymes [BR:bvi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Bcep1808_5385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(2331594..2332541)
Genome map
AA seq 315 aa AA seqDB search
MATDNTRCKAAIIGSGNIGTDLMIKIMRSGKHLEIAAMVGIDPASDGLARAARLGVATTH
EGVEGLARLPVFDEIDFVFDATSAGAHVKNDAFLRALKPGIRMIDLTPAAIGPYCVPVVN
LDAHLDAPNVNMVTCGGQATIPMVAAVSRVAKVHYAEIVASISSKSAGPGTRANIDEFTE
TTSKALEAVGGAGKGKAIIVLNPAEPPLMMRDTVYLLSEAADRALIEASVSEMAAAVQAY
VPGYRLKQSVQFDDIPAAAPLHIPGLGRFSGLKTSIFVEVEGAAHYLPAYAGNLDIMTSA
ALATAERMAASLVNA
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggcaacagacaacacccggtgcaaggccgcgatcatcggctccggcaacatcggcacc
gacctcatgatcaagatcatgcgcagcggcaagcacctcgaaatcgccgcgatggtcggc
atcgatccggcctcggacggcctcgcgcgcgccgcgaggctcggcgtggcgacgacgcat
gaaggcgtggaagggctcgcgcgcctgcccgtgttcgacgagatcgacttcgtgttcgat
gcgacgtcggccggcgcacatgtgaagaacgacgcgttcctgcgcgcgctcaagcccggc
attcggatgatcgacctgacgcccgctgccatcggcccgtactgcgtgccggtggtgaat
ctcgacgcgcatctcgatgcgccgaacgtgaacatggtcacgtgcggcgggcaggcgacg
atcccgatggtcgccgcggtgtcgcgcgtcgcaaaggtgcattacgcggagatcgtcgcg
tcgatcagcagcaagtcggcagggccgggcacgcgcgccaacatcgacgagttcacggag
acgacgtcgaaggcgctcgaagcggtcggcggtgccggcaagggcaaggcgatcatcgtg
ctcaatccggccgagccgccgctcatgatgcgcgacacggtgtatctgctgtccgaagcg
gcggaccgcgcgctgatcgaagcgtcggtcagcgagatggccgctgcggtccaggcctat
gtgcccggctatcggctgaaacagtccgtgcagttcgacgacatccccgccgctgcgccg
ttgcatatccccggactcggccgtttcagcggactcaagacttcgatcttcgtcgaagtg
gagggcgcggcgcattatctgccggcctacgccggcaatctcgacatcatgacgtccgcc
gcgctggcaacggccgagcgcatggccgcgtcgctcgtgaacgcctga

DBGET integrated database retrieval system