KEGG   Burkholderia vietnamiensis: Bcep1808_5495Help
Entry
Bcep1808_5495     CDS       T00493                                 

Definition
hypothetical protein
Organism
bvi  Burkholderia vietnamiensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:44669..45208
Genome map
AA seq 179 aa AA seqDB search
MNKIRTILLGAALTAIASAAFAQTAQTGAAGSAGVGAQVQTPLLGGGVGVQAGAGANAAG
SGAGAGNLVGGALHGVDNTVSGVGSAAGNAVDGATHALGSAAGSAKDAATSAAHATKSHV
KRVASSAKSHAQGAVSTAGDVAGEAKAKAGEALEGAANPVQGGASVGLKGSASAQGGAL
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagattcgtacgatcctgcttggcgccgcgctgacggcaatcgcatcggctgcc
ttcgcacaaacggctcagacgggcgccgcgggctccgctggcgttggcgcacaagttcag
acgccgttgctcggcggcggcgtgggcgtgcaggcgggtgccggcgcgaacgcggcgggc
tcgggtgcgggcgcgggcaatctcgtcggcggggcgctgcacggcgtcgacaacacagtc
agcggcgtgggctcggccgcgggcaacgcagtcgacggcgcgacgcacgcactcggttcg
gctgccggctcggccaaggacgcggcgacatcggctgcgcatgcgaccaagtcgcacgtg
aagcgcgtcgcaagttccgcgaagagccacgcgcaaggtgcggtctcgacggccggcgac
gtcgccggcgaagcgaaggcaaaggccggcgaagcgctcgaaggtgcggcgaacccggta
cagggcggcgcatcggtcggattgaagggctcggcgtcggcgcaaggcggtgcgctgtaa

DBGET integrated database retrieval system