KEGG   Burkholderia vietnamiensis: Bcep1808_5505Help
Entry
Bcep1808_5505     CDS       T00493                                 

Definition
AMP-dependent synthetase/ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bvi  Burkholderia vietnamiensis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bvi01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bvi00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bvi00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bvi00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:bvi00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:60596..62263
Genome map
AA seq 555 aa AA seqDB search
MRNGATARAAPAYADAVAGFRIETAAAQLHGDLEQGLNACVECCDRHAAANPDAIALDWI
DAGGRHSSYTFAQMLALSARVANLLVEQGVQPGDVVAGMLPRTPELVATILGTWRAGAVY
QPLFTAFGPKAIEHRLRMSHARVVVTNVANRGKLDEVADCPRIATVREPGEALPAGDIDF
RAALDAQPDAFEPVLRKGSDLFMMMSTSGTTGLPKGVPVPLRALLAFGAYMRDAIDLCAG
DRFWNIADPGWAYGLYYAITGPLLLGHATTLYEGGFTVDSTYDVIERLGITSLAGSPTAY
RMLMAAGPEAATRVKGKLRVVSSAGEPLNPEVVRWFDAVLDAPIYDHYGQTELGMVVNNH
HGLAHVVHTGSAGLAMPGYRVAVLDEAGRELGPGEPGNLAIDIARSPLLWFDGYWQQAMP
AIAGGYYRTGDNVELEPDGTVSFIGRADDVITSSGYRIGPFDVESALLEHPAVSEAAVIG
VPDPERTEIVKAFVVLSQGFEGTPALADELSQHVKRRLSAHAYPRAIDFVDALPKTPSGK
IQRFVLRKMEAEKPA
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaatggagcaaccgcccgggcggcaccggcatacgccgacgccgttgccggcttc
cgtatcgagacggccgccgcgcagctgcacggcgacctcgagcagggtctgaacgcctgc
gtcgaatgctgcgaccgccatgccgcggcgaaccccgacgccatcgcgctcgactggatc
gatgccggcggccgacacagcagctatacgttcgcgcagatgctcgcgctgtcggcgcgc
gtcgcgaacctgctggtcgaacagggcgtgcagcccggcgacgtggtggccggcatgttg
ccgcgtacgcccgagctggtcgcgacgatcctcggcacgtggcgcgccggcgccgtctat
cagccgcttttcaccgcgttcgggccgaaggcgatcgaacatcggttgcgcatgagccac
gcacgcgtcgtcgtcaccaacgtcgcgaatcgcggcaagctcgacgaggtcgcggattgc
ccgcgaatcgcgaccgtgcgcgaaccgggcgaggcgctcccggccggcgacatcgacttc
cgtgccgccctcgacgctcagcccgatgcgttcgagccggtgctgcgcaagggcagcgac
ttgttcatgatgatgtcgacgtcgggcacgacgggcctgccgaagggcgtgcccgttcca
ctgcgcgcgctgctcgcgttcggcgcgtacatgcgcgacgcgatcgatctgtgcgccggc
gatcgcttctggaacatcgccgatccgggctgggcctacggcctctactacgcgatcacc
ggcccgctgctgctcggtcacgcgacgacgttgtacgaaggcggcttcacggtcgacagc
acgtacgacgtgatcgaacggctcggcatcacgagcctcgccggttcgccgaccgcatac
cggatgctgatggcggccggccccgaagctgcaacacgcgtgaagggcaagctgcgcgtc
gtgagcagcgcgggcgaaccgctgaacccggaagtcgtgcgctggttcgacgccgtgctc
gacgcgccgatctacgaccactacgggcagaccgagctcgggatggtcgtgaacaatcat
cacgggctcgcgcacgtggttcataccgggtcggccgggctggcgatgcccggctatcgc
gtcgcggtgctcgacgaagcgggccgcgagctcggccccggcgagcccggcaatctcgcg
atcgatatcgcgcgctcgccgctgctgtggttcgacggctactggcagcaggcgatgccg
gcgatcgcgggcggctactaccggaccggcgacaacgtcgagctcgagccggacggcacc
gtgagcttcatcggacgcgcggacgacgtgatcacgtcgtccggctaccggatcggcccg
ttcgacgtcgaaagcgcgctgctcgagcacccggccgtgagcgaggcggcggtgatcggc
gtgccggacccggagcgcaccgagatcgtgaaggccttcgtcgtgctgtcgcaaggcttc
gaaggcacgccggcgctggccgacgagttgagccagcacgtgaagcggcgtttgtccgcc
cacgcatatccccgcgcgatcgacttcgtcgacgcgctgccgaaaaccccgagcggcaag
atccagcgcttcgtactgcgcaagatggaagccgaaaagccggcttga

DBGET integrated database retrieval system