KEGG   Burkholderia vietnamiensis: Bcep1808_5646Help
Entry
Bcep1808_5646     CDS       T00493                                 

Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
bvi  Burkholderia vietnamiensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bvi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcep1808_5646
   00052 Galactose metabolism
    Bcep1808_5646
Enzymes [BR:bvi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Bcep1808_5646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:216244..217425
Genome map
AA seq 393 aa AA seqDB search
MNPLSTRRPVLAICACATFALGSNAASTASAAAAAPDVSVSRAHYGTTAAGQPVSQYTLA
NAHGVTLKIITYGGIVTALDVPDRNGKPADIVLGFDSLRDYEAHNGNIHFGALIGRYANR
IARGRFVLDGKTWTLPVNDPPNTLHGGPNSFDAKVWTVTGTRSDADGSSVTLRYVSPDGE
NGFPGTLTTDVTYTLTRDDLIRIDYRATTNRDTVVNLTNHSYFNLAGHDGGSVERQLIEI
AAARFTPTDATSIPTGALASVAGTPMDLRQLTPIGARLRDRDPQLAIAHGYDQNWVLDHG
GQPAPAFAARAYDPASGRFLEVYTTQPGLQFYTSNGLNGSVAGKGGTLYRQTDAFALEAE
HFPDSPNRPAFPTTVLKPGETLHEVTVWRVGAR
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgctctcgacacggcggccggtgctcgcgatctgtgcatgcgcaacgtttgct
ctcggctcgaacgctgcgtcgacggcatcggccgcagcggccgcgcccgacgtgtccgtc
agccgtgcgcattacggcaccaccgcggccggccagccggtcagccagtacacgctcgcg
aacgcgcacggcgtgacgctgaagatcatcacgtacggcggcatcgtgacggcgctcgac
gtgccggaccgcaacggcaagcccgccgatatcgtgctcggcttcgattcgctgcgcgac
tacgaggcgcacaacggcaacatccatttcggtgcgttgatcggccgctatgcgaaccgc
atcgcacgcgggcgcttcgtgctcgacggcaagacctggacgctgccggtcaacgatccg
ccgaatacgctgcatggcggccccaatagtttcgacgcgaaggtgtggacggtgacgggc
acgcgcagcgacgccgacggttcgagcgtgacgctgcgttacgtgagccccgatggcgaa
aacggctttcccggcacgctgaccaccgacgtgacctacacgctgacgcgcgacgacctg
atccgcatcgactatcgcgcgacgacgaaccgggacacggtcgtcaacctgaccaaccac
agctatttcaatctcgcggggcacgacggcggcagtgtcgaacggcaactgatcgagatc
gccgcggcgcgcttcacgccgaccgatgcgacgtcgattccgaccggcgcgctggcgagc
gtggccggcacgccgatggacctgcgccagctgacgccgatcggcgcgcgtctgcgcgat
cgtgatccgcagctcgccattgcgcacgggtacgaccagaactgggtgctcgaccacggc
ggccagcccgcgccggcgttcgccgcgcgtgcgtacgatccggcatcgggacggtttctg
gaggtctacacgacgcagccggggctgcagttctatacgtccaacgggttgaacggcagc
gtcgccggcaagggcggcacgctttaccggcagaccgacgcgttcgcgctggaggccgag
cattttcccgattcgccgaaccggccggcgttcccgacgaccgtgctcaaacccggcgag
acgctgcatgaggtgacggtgtggagggtgggggcgcggtga

DBGET integrated database retrieval system