KEGG   Burkholderia vietnamiensis G4: Bcep1808_5646Help
Entry
Bcep1808_5646     CDS       T00493                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
bvi00010  Glycolysis / Gluconeogenesis
bvi00052  Galactose metabolism
bvi01100  Metabolic pathways
bvi01110  Biosynthesis of secondary metabolites
bvi01120  Microbial metabolism in diverse environments
bvi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bvi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcep1808_5646
   00052 Galactose metabolism
    Bcep1808_5646
Enzymes [BR:bvi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Bcep1808_5646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim ASFV_J13L
Motif
Other DBs
NCBI-ProteinID: ABO58584
JGI: Bcen18085646
UniProt: A4JQN1
Position
3:216244..217425
Genome map
AA seq 393 aa AA seqDB search
MNPLSTRRPVLAICACATFALGSNAASTASAAAAAPDVSVSRAHYGTTAAGQPVSQYTLA
NAHGVTLKIITYGGIVTALDVPDRNGKPADIVLGFDSLRDYEAHNGNIHFGALIGRYANR
IARGRFVLDGKTWTLPVNDPPNTLHGGPNSFDAKVWTVTGTRSDADGSSVTLRYVSPDGE
NGFPGTLTTDVTYTLTRDDLIRIDYRATTNRDTVVNLTNHSYFNLAGHDGGSVERQLIEI
AAARFTPTDATSIPTGALASVAGTPMDLRQLTPIGARLRDRDPQLAIAHGYDQNWVLDHG
GQPAPAFAARAYDPASGRFLEVYTTQPGLQFYTSNGLNGSVAGKGGTLYRQTDAFALEAE
HFPDSPNRPAFPTTVLKPGETLHEVTVWRVGAR
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgctctcgacacggcggccggtgctcgcgatctgtgcatgcgcaacgtttgct
ctcggctcgaacgctgcgtcgacggcatcggccgcagcggccgcgcccgacgtgtccgtc
agccgtgcgcattacggcaccaccgcggccggccagccggtcagccagtacacgctcgcg
aacgcgcacggcgtgacgctgaagatcatcacgtacggcggcatcgtgacggcgctcgac
gtgccggaccgcaacggcaagcccgccgatatcgtgctcggcttcgattcgctgcgcgac
tacgaggcgcacaacggcaacatccatttcggtgcgttgatcggccgctatgcgaaccgc
atcgcacgcgggcgcttcgtgctcgacggcaagacctggacgctgccggtcaacgatccg
ccgaatacgctgcatggcggccccaatagtttcgacgcgaaggtgtggacggtgacgggc
acgcgcagcgacgccgacggttcgagcgtgacgctgcgttacgtgagccccgatggcgaa
aacggctttcccggcacgctgaccaccgacgtgacctacacgctgacgcgcgacgacctg
atccgcatcgactatcgcgcgacgacgaaccgggacacggtcgtcaacctgaccaaccac
agctatttcaatctcgcggggcacgacggcggcagtgtcgaacggcaactgatcgagatc
gccgcggcgcgcttcacgccgaccgatgcgacgtcgattccgaccggcgcgctggcgagc
gtggccggcacgccgatggacctgcgccagctgacgccgatcggcgcgcgtctgcgcgat
cgtgatccgcagctcgccattgcgcacgggtacgaccagaactgggtgctcgaccacggc
ggccagcccgcgccggcgttcgccgcgcgtgcgtacgatccggcatcgggacggtttctg
gaggtctacacgacgcagccggggctgcagttctatacgtccaacgggttgaacggcagc
gtcgccggcaagggcggcacgctttaccggcagaccgacgcgttcgcgctggaggccgag
cattttcccgattcgccgaaccggccggcgttcccgacgaccgtgctcaaacccggcgag
acgctgcatgaggtgacggtgtggagggtgggggcgcggtga

DBGET integrated database retrieval system