KEGG   Burkholderia vietnamiensis: Bcep1808_5776Help
Entry
Bcep1808_5776     CDS       T00493                                 

Definition
porin
Organism
bvi  Burkholderia vietnamiensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:360275..361312
Genome map
AA seq 345 aa AA seqDB search
MQTRRFRGSVGKLAVVLGVCTCTGIAHAQSSVSLYGLADAFVGEVHPAGAAGNAWQVGSG
GMTTSYWGMSGTEELGGGMKAVFTLESFYRINGGQVGSFPGQSFFGRNAFVGLSGHFGEL
TLGRNTAPLFVSTLLFNPFGNSFVFSPIVVHSFLGSAMGAASLQSDTAIDNSLLYQTPEV
AGLSGSVLYSNAGVAGHAGQANYSANVLYFAGPFSATAAVQSLHTASLFLNGATVQTAWM
AGGAYRLRGAKLFAQYERVDNNNHVTDDTVQLGASVRIGLGNVLMSWAGTRRRPSVGDHI
RWSTVALGYDYPLSKRTDVYAAWRYDTITGVSTGNSVGAGMRVRF
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgcagacaagaagatttcggggaagcgtgggtaagttggctgtcgtgttgggcgtgtgc
acctgtaccgggatcgcgcatgcgcagtcatcggtctcgttgtatgggctagcggacgcg
ttcgttggcgaagtgcatcccgccggtgctgccggcaatgcgtggcaagtcggttctggc
gggatgacgacttcgtactgggggatgtccggtacagaggagctgggcgggggtatgaaa
gctgtcttcacgctggagagtttttatcgcatcaacggcggccaggtcggctcgtttcct
ggacagtcatttttcgggcgaaacgccttcgttggcctgagcggccatttcggggagttg
acgctggggcgcaatacggcgccgctgttcgtgtcgacgctgctgttcaatccgttcggc
aattcgttcgtcttctcgccgatcgtcgtgcacagtttccttggctcggcaatgggggct
gcgtcactccagagcgatacggcgatcgacaattcgctcctttatcagacgcccgaggtg
gccggtctgtcgggaagcgttctttacagcaacgcaggcgttgccggccatgccgggcaa
gctaactatagcgcgaacgtgttgtacttcgccggcccgttttccgcaacggccgcggtg
cagagtctgcacacggcatcgctgtttcttaacggcgcaaccgtacagaccgcctggatg
gcaggtggcgcgtatcggttgcgtggggcgaagctgttcgcacaatacgaacgcgtggac
aacaacaatcatgtcacggacgacacggtgcaactcggagcaagcgttcggatagggtta
ggaaacgtactgatgtcgtgggcgggaacgcggcggcgaccgtcggtgggcgatcatatc
cgttggtcgacggtcgcattgggttacgactacccgttgtcgaagcgaaccgatgtgtat
gcagcttggcgttatgacacgatcacaggtgtgtcgacgggcaatagcgtgggtgccggg
atgcgggtcagattctga

DBGET integrated database retrieval system