KEGG   Burkholderia vietnamiensis: Bcep1808_5809Help
Entry
Bcep1808_5809     CDS       T00493                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bvi  Burkholderia vietnamiensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bvi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Bcep1808_5809
Enzymes [BR:bvi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Bcep1808_5809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:complement(391188..393425)
Genome map
AA seq 745 aa AA seqDB search
MTTDVSIAELARAAGLEPDWTDAGGVARRVEDDALVALVDALGWPCGTPIERVDSAAALA
DARNAPPQLVTGDAGAPLALPHAVAPPGARYRITLESGAHVDGRIAASGESGTLAPLDEP
GYHTLDIGARRIALAIAPPRARPFAGERMPQTDGRWGIAAQLYGLRRTTDDGAGDYSALA
ELAAHAARHGAHAVAISPTHAGYPALPEHDSPYSPSSRRWHNVAYLDCEAVPGADFVRRT
REPSDADGRAPDTPLIDWPHVLPLRLRRLCACFGAWRENGEPARDAFERFRAAGGAALDA
HARFDALQAFCIENGIGADWRQWPAQWRDPTSPEVDAFAQAHADTIAFHTFLQWCASDAL
GRAQATARDAGMALGLIADLAVGSDCAGSDAWAHGTTLLRGVSVGAPPDLFNTDGQAWGV
TTWTPDALRATGFAPFIELLRAAFAHAGGIRIDHVLGLARLWIVPHGRSPRDGAYLRYPL
DDLLRIVALEAARHRAIAIGEDLGTVPAGFRERIAAQGIAGMRVLWFERDADGAFRPPSD
WDRDTVAMTSTHDLPTVAGWWRGVDLEWRRGAHAQRDDGPAHGAGDDVGLAAAAHGADGA
DGDERNAPCLRDDADDAGRDPSPPDPDLAAAAASAETERAAERTALWRALQRAGCAPADQ
AMPPPDAPPVDAVVAYVARSPSPLAIVPLEDLLGLDAQPNLPGPPCGHPNWLRRLPRAID
ALFDAPVRERIAAIERARTARREDA
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgacgtatcgatcgccgagctcgcgcgcgccgcagggctcgaaccggactgg
accgacgcgggcggtgtcgcgcgtcgggtggaagacgacgcgctcgtcgcactggtcgac
gcactcggctggccctgcggcacgccgatcgagcgcgtcgacagcgcggccgcgcttgcc
gatgcgcgcaacgcgccgccgcagctcgtcaccggcgacgccggtgcgccgctcgcgctg
ccacacgccgtcgcgccgcccggcgcgcgctaccggatcacgctcgaatcgggcgcgcac
gtcgacgggcgcatcgcagcgagcggcgaatccggcacgctggcgccgctcgacgagccc
ggctaccacacgctcgacatcggcgcacgacgcattgcgctcgcgatcgcgccgccgcgc
gcgcggccgttcgccggcgagcgcatgccgcaaaccgacgggcgctggggaatcgcagcg
cagctgtatgggctgcgccgcaccaccgacgacggcgccggcgactactcggccctcgcc
gaactcgccgcgcacgcagcaaggcatggcgcgcacgcggtcgcgatcagcccgacgcac
gccggctatccggcgctgcccgagcacgacagcccgtattcgccgtcgtcgcggcgctgg
cacaacgtcgcgtatctcgactgcgaggcggtgccgggcgcggacttcgtgcgacgtacg
cgcgagccgtccgacgccgacggccgcgcgcccgacacgccgctgatcgactggccgcac
gtgctgccgctgcgactgcggcgcctgtgtgcgtgcttcggcgcctggcgcgaaaacggc
gagccggcgcgcgacgcattcgaacgattccgcgcggccggcggcgcggcgctcgacgcg
catgcgcgcttcgacgcgctgcaggcgttctgcatcgagaacgggatcggcgcggactgg
cggcaatggcccgcgcagtggcgagacccgacgtcgcccgaggtcgacgcgttcgcgcag
gcccacgcggacacgatcgccttccacacgttcctgcaatggtgcgcgtccgacgcgctc
ggccgcgcgcaggcgacggcgcgcgatgcagggatggcgctcgggttgatcgccgatctg
gcggtcggctccgattgcgcgggcagcgatgcatgggcgcacggcacgacgctgttgcgc
ggcgtgtcggtcggcgcgccgccggacctgttcaacaccgacggccaggcgtggggcgtg
acgacctggacgccggacgcgctgcgcgcgaccggcttcgcgccgttcatcgagctgctg
cgcgcggcgttcgcgcatgcgggcggcatccgcatcgatcacgtgctcggcctggcgcgg
ctgtggatcgtgccgcacggccgctcgccgcgcgacggcgcgtacctgcgctatccgctc
gacgatctgctgcgcatcgtcgcgctggaggcggcccggcatcgcgcgattgcgatcggc
gaggatctcggcacggtgccggccggctttcgcgagcggatcgccgcgcagggcatcgcc
ggcatgcgcgtgctgtggttcgagcgcgacgccgacggcgcattccggccgccgtcggac
tgggatcgcgacacggtcgcgatgacgtcgacgcacgatctgccgaccgtcgccggctgg
tggcgcggcgtcgatctcgaatggcggcgcggcgcgcacgcgcagcgggacgacgggccc
gcacacggcgcgggcgacgacgtcgggctggccgcggccgcacatggggcggatggcgcg
gatggcgatgaacgcaacgcgccgtgcttgcgcgacgacgccgatgacgccggccgcgat
ccatcgccgcccgatcccgacctcgcggcggctgccgccagcgcggaaaccgagcgcgcg
gccgaacgcacggcgctgtggcgtgcgctgcagcgcgccggctgtgcgccggccgatcag
gccatgccgccgcccgatgcgccgccggtcgacgcagtcgtcgcctacgtcgcgcgcagc
ccgtcgccgctcgcgatcgtgccgctcgaagacctgctcggcctcgacgcacagccgaac
cttcccggcccgccgtgcggccatccgaactggctgcggcggctgccgcgcgcgatcgac
gcgctgttcgacgcaccggtgcgcgagcgcatcgccgcgatcgaacgcgcacgcactgcg
cgccgggaggacgcatga

DBGET integrated database retrieval system