KEGG   Burkholderia vietnamiensis: Bcep1808_6309Help
Entry
Bcep1808_6309     CDS       T00493                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
bvi  Burkholderia vietnamiensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bvi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bcep1808_6309
   01230 Biosynthesis of amino acids
    Bcep1808_6309
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcep1808_6309
   00030 Pentose phosphate pathway
    Bcep1808_6309
   00051 Fructose and mannose metabolism
    Bcep1808_6309
   00052 Galactose metabolism
    Bcep1808_6309
  Energy metabolism
   00680 Methane metabolism
    Bcep1808_6309
Enzymes [BR:bvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Bcep1808_6309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:complement(880188..881123)
Genome map
AA seq 311 aa AA seqDB search
MTDIVTVTLNPAVDVATSVEHIVDTHKLRCARPRRDPGGGGINVARTIHRLGGDCIALYL
AGGPTGDVLTLLLEAERLPSVRIRIVGETRENVCVTETSTGREYRFLMPGPSVSDAEWRD
CAARLDAMQPAPRYLVLSGSLPPGAPDDLYATLARAAKARGSRVVVDASGRALGAALEEG
VHLVKPSIGELSALAGEALDDASACRVASELVARGQAEIVALTLGARGAWVVTRDRSLRL
PGRPAAVCSTVGAGDSFVGGMVWALARGVPLDDACRYALAASASSVEHPGTALCTRADVE
RIHDEIVALAS
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgacagatatcgttaccgttaccctgaacccggccgtcgacgtcgcgacgtcggtcgag
cacatcgtcgacacgcacaagctgcgatgcgcgcggccgcgccgcgacccgggcggcggc
ggcatcaacgtcgcgcggaccatccaccggctcggcggcgactgcatcgcgctgtacctg
gccggcggcccgaccggcgacgtgctgacgttgttgctcgaggccgagcgcctgccgagc
gtgcgcatccggatcgtcggcgagacgcgcgagaacgtctgcgtgaccgagacctcgacc
gggcgcgaataccgctttttgatgccggggccatcggtgagcgacgccgagtggcgcgac
tgcgcggcccgcctcgacgcgatgcagccggcgccgcgctatctcgtgctgagcggcagt
ctgccgcccggcgcgcccgacgatctgtacgcgacgctcgcacgggccgcgaaggcgcgg
ggcagtcgcgtcgtcgtcgacgcgtcgggccgtgcgctgggcgcggcgctggaggagggc
gttcatctcgtgaagcccagtatcggcgaactcagcgcgctggccggcgaagcgctcgac
gatgcgtccgcgtgccgagtggcgagcgaactcgtcgcgcgcggccaggccgagatcgtc
gcgttgacgctcggcgcgcgcggcgcgtgggtcgtcacgcgcgatcggtcgttgcgtctg
cccgggcggccggcagcggtatgcagcacggtcggcgccggcgacagtttcgtcggcggc
atggtgtgggcgctggcgcgcggcgtgccgctcgacgacgcgtgccgctatgcgctcgcc
gcatcggcttcgtcggtcgagcatccgggcaccgccctgtgcacgcgcgcggacgtcgag
cgcatccacgacgaaatcgttgcgctcgcaagctga

DBGET integrated database retrieval system