KEGG   Burkholderia vietnamiensis: Bcep1808_6339Help
Entry
Bcep1808_6339     CDS       T00493                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bvi  Burkholderia vietnamiensis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bvi00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Bcep1808_6339
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcep1808_6339
  Lipid metabolism
   00071 Fatty acid degradation
    Bcep1808_6339
  Amino acid metabolism
   00350 Tyrosine metabolism
    Bcep1808_6339
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Bcep1808_6339
   00626 Naphthalene degradation
    Bcep1808_6339
Enzymes [BR:bvi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Bcep1808_6339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:complement(913384..914373)
Genome map
AA seq 329 aa AA seqDB search
MLAMMFDGTTPTLREARVPDPVPAAGQLLIDVHACGVCRTDLHVVDGELAHPKRPLIPGH
EIVGTVRALGAGVTGFAVGDRVGVPWLGATCGHCVYCASGRENLCDSPGFTGYTIDGGYA
ERTVADHRYCVHLPRRYSDLEAAPLLCAGLIGYRTLRMAGNAQRIGIYGFGAAAHLVAQV
AFFEGRKVFALTRPGDAAAQQLALSLGAVWAGGSDEMPPEPLDAALIFAPVGALVPAALR
AVDKGGIVVCGGIHMSDIPSFPYAWLWGERRIASVANLTRVDAVEFMRLADAMPLRVEAV
RYALTDANRALDDLRAGRVSGAAVLGMGG
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgcttgcgatgatgttcgacggcacgacgcccacgctgcgcgaggcgcgcgtgccggac
ccggtgcctgcagccggccagttgctgattgacgtccatgcgtgcggcgtatgccggacc
gatctgcatgtggtcgacggtgaactcgcgcatccgaagcggccgctgattcccgggcac
gagatcgtcggcacggtgcgcgcgctgggcgcgggcgtcacgggcttcgccgtcggcgat
cgcgtgggcgtgccctggctcggcgcgacgtgcggacactgcgtgtattgcgcgtccggc
cgcgaaaacctgtgcgacagccccggcttcaccggctatacgatcgacggcggctatgcg
gaacgcaccgtggccgaccatcggtattgcgtgcatctgccgcggcgctattccgacctc
gaagccgcgccgctgctgtgcgcggggctgatcggctaccgcacgctgcgcatggccggc
aacgcccagcgcatcggcatctacggcttcggggcggccgctcatctggtcgcgcaggtc
gcgtttttcgaaggacgcaaggtgttcgcgttgacgcgccccggcgatgccgcggcgcag
cagctcgcgctgtcgctcggcgcggtgtgggccggcggcagtgacgaaatgccgcccgag
ccgctcgatgccgcgctgatcttcgcgccggtcggcgcgctggtgccggcagcactgcgc
gcggtggacaagggcgggatcgtcgtgtgcggcggcattcacatgagcgacatccccagc
tttccgtacgcgtggctgtggggcgagcgccggatcgcgtcggtggcgaacctcacgcgt
gtggatgcggtggaattcatgcggctcgccgacgcgatgccgctgcgcgtcgaggccgtg
cgctatgcattgaccgatgcgaaccgcgcgctcgacgatctgcgcgccggccgcgtgtcg
ggcgcggccgtgctcgggatgggcgggtaa

DBGET integrated database retrieval system