KEGG   Burkholderia vietnamiensis: Bcep1808_6402Help
Entry
Bcep1808_6402     CDS       T00493                                 

Definition
acriflavin resistance protein
Organism
bvi  Burkholderia vietnamiensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:983473..986739
Genome map
AA seq 1088 aa AA seqDB search
MWIVRLALRRPYTFVVLALLIFIAGPLALLRMPTDIFPNIDIPVVSIVWSYNGFSAEDMA
KRITSNYERALTSDVDDIEHIESQSLNGVSVVKVFFHPGADINRAIAEAASNAASILRIL
PPGTLPPNIITYNASTVPILQLGLSSDTLAEQQLYDLGNSFIRTQLATVQGAAVPLPYGG
KIRQIVVDLDTRALQAKGLAPIDVVNAINAQNLILPGGTAKIGTHEYDVQLNGSTQTVAA
LNDLPVKTIGGSVVYVRDVAHVRDGYAPQTNIVRADGKRAALLTVEKTGSASTLTIIDQV
KAMLPKIAAGLPKALHIAALDDQSVFVKSAIQGVVREALIAACLTALMILLFLGSWRATL
IIAVSIPLAVLTSLLALGALGQTINIMTLGGLALAVGILVDDATVAIENITHHLERGEPL
EDAILTGAGEIAVPTFVSTLSICIVFVPMFLLTGVARYLFVPMAEAVIFAMVASYFFSRT
LVPTLAMVLMRAKGQGRPPRGVFARIAGLQAAFERRFDAIRLGYRALLAAAIAHRRRFAA
AFVLACVASTGLFAFAGQDFFPAIDTGEIRLHLRAPTGTRIEQTARLTDEVEAKVRSVIP
ARELAGMLDNIGVPVSGINLTYDSSDPIGTEDADVMITLKPGHAPTAAYVARLRNLLAQS
FPGVTFAFLPADIVSQILNFGLPAPVDIQIVGNKLDQNRAVANALLAKLRGVRGLVDARI
QQPGDEPAIDVNVDRTKAIEAGLQQRDVAQNLLIALSGSSQTTPNFWLDPRNGVSYPVLV
QTPQYTIDSLQALANVPLPTSDAPSPQRPAGGPAAGAPAQNLLGTLGSFSRTTQQAVVSH
YNVQPVLDIFASVQGRDLGAVTADVTKLVDDARAQLPPGSSIVLRGQVQAMHESFAGLLG
GLALAIALVYLLMVVNFQSWLDPLVIVGGLPASLAGIAWMLFVTRTTLSVPALTGTILCI
GIATANSILVVNAARELLAGGASPWQAALDAGFSRFRPVVMTALAMLIGMLPMALGLGDG
GEQNAPLGRAVIGGLAFGTLSTLLFVPVVFGFVHAWLERRRDAAGARGALDMRDAPGAPE
APDTPALR
NT seq 3267 nt NT seq  +upstreamnt  +downstreamnt
atgtggatcgtccggctcgcattgcgcaggccctatacgttcgtcgtgctcgcgctgctg
atcttcatcgcggggccgcttgcgctgctgcgcatgccgaccgacatctttccgaacatc
gacatcccggtcgtcagcatcgtctggtcgtacaacggcttctccgccgaagacatggcc
aagcgcatcacgtcgaactacgagcgcgcgctcacgtccgacgtcgacgacatcgagcac
atcgaatcgcagtcgctgaacggcgtgtcggtcgtgaaggtgttcttccaccccggcgcg
gacatcaatcgcgcgatcgcggaagccgccagcaacgccgcgtcgatcctgcgcatcctg
ccgcccggcacgctgccgccgaacatcatcacgtacaacgcgtcgacggtgccgatcctg
cagctcgggctgtcgagcgacacgctcgccgaacagcagctgtacgacctcggcaacagt
ttcatccgcacgcagctcgcaaccgtccagggcgcggccgtgccgctgccgtacggcggc
aagatccgccagatcgtcgtcgatctcgacacgcgcgcgctgcaggcgaaggggctcgcg
ccgatcgacgtggtgaacgcgatcaacgcgcagaacctgatcctgccgggcggcaccgcg
aagatcggcacgcacgagtacgacgtgcagctgaacggcagcacgcagacggtcgccgcg
ctgaacgacctgccggtgaagacgatcggcggcagcgtcgtctatgtgcgcgacgtcgcc
cacgtgcgcgacggctacgcgccgcagaccaacatcgtgcgcgccgacggcaagcgcgcg
gcgctgctgaccgtcgagaagaccggcagcgcatcgacgctgacgatcatcgaccaggtg
aaggcgatgctgccgaagatcgcagccgggctgccgaaggcgctgcacattgcggcgctc
gacgaccagtcggtgttcgtgaagtccgcgatccagggcgtcgtgcgcgaggcgctgatc
gccgcgtgcctgaccgcgctgatgatcctgctgttcctcggcagctggcgcgcgacgctg
atcatcgcggtgtcgattccgctcgcggtgctgacgtcgctgctcgcgctcggcgcgctc
ggccagaccatcaacatcatgacgctcggcgggctcgcgctggcggtcggcatactcgtc
gacgacgcgaccgtcgcgatcgagaacatcacgcatcatctcgaacgcggcgagccgctc
gaggacgcgatcctcaccggcgccggcgagatcgcggtgccgaccttcgtgtcgacgctg
tcgatctgcatcgtgttcgtgccgatgttcctgttgacgggcgtcgcacgctacctgttc
gtgccgatggccgaggcggtgatcttcgcgatggtcgcgtcgtacttcttctcgcgcacg
ctggtgccgacgctcgcgatggtgctgatgcgcgcgaagggccagggccgcccgccgcgc
ggcgtgttcgcgcgtatcgccggcctgcaggccgcgttcgaacgccgcttcgacgcgatc
cggctcggctatcgcgcgctgctcgccgcggcgatcgcgcaccggcgccgcttcgcggcc
gcgttcgtgctggcgtgcgtggcgtccacgggcctgttcgcgttcgccggccaggacttc
ttcccggcgatcgacaccggcgagatccgcctgcatctgcgcgcgccgaccggcacgcgg
atcgagcagaccgcacggctgaccgacgaagtcgaggccaaggtgcgcagcgtgattccg
gcgcgcgaactggccggcatgctcgacaacatcggcgtgccggtgagcgggatcaacctc
acctacgactcgtccgacccgatcggcaccgaggacgccgacgtgatgatcacgctgaag
ccgggccacgcgccgaccgccgcgtacgtcgcacggctgcgcaacctgctcgcgcagtcg
ttccccggcgtgacgttcgcgttcctgccggccgacatcgtgagccagatcctcaatttc
gggctgcccgcgccggtcgacatccagatcgtcggcaacaagctggatcagaaccgcgcg
gtcgcgaacgcgctgctcgcgaaactgcgcggcgtgcgcggtttggtcgacgcgcgcatc
cagcagcccggcgacgagccggcgatcgacgtgaacgtggaccgcaccaaggcgatcgag
gccgggctccagcagcgcgacgtcgcgcagaaccttttgatcgcgctgtccggcagctcg
cagacgacgccgaacttctggctcgatccgcgcaacggcgtgagctaccccgtgctcgtg
cagacgccgcagtacacgatcgattcgctgcaagcgctcgcgaacgtgccgttgccgacc
agcgacgcgccgtcgccgcagcgcccggccggcggcccggcggccggtgcgcccgcgcaa
aacctgctcggcacgctcggcagcttctcgcgcacgacgcagcaggcggtcgtgtcgcac
tacaacgtgcagccggtgctcgacattttcgcgtcggtgcaggggcgcgacctcggcgcg
gtcacggccgacgtgacgaagctcgtcgacgacgcgcgcgcgcagctgccgcccggctcg
tcgatcgtgctgcgcggccaggtgcaggcgatgcacgagtcgttcgccgggctgctcggc
ggtctcgcgctcgcgatcgcgctggtctacctgctgatggtcgtcaatttccagtcgtgg
ctcgatccgctcgtgatcgtcggcggcctgccggcgtcgctggccggcatcgcgtggatg
ctgttcgtgacgcgcacgacgctgtcggtgccggcgttgaccgggacgatcctgtgcatc
ggcatcgcgaccgcgaacagcatcctcgtcgtcaatgcggcgcgcgagctgctcgccggc
ggcgcatcgccgtggcaggccgcgctcgacgccggcttcagccgcttccgtccggtcgtg
atgaccgcgctcgcgatgctgatcgggatgctgccgatggcgctcggcctcggcgacggc
ggcgagcagaacgcgccgctcggccgcgcggtgatcggcgggctcgcgttcggcacgctg
tcgacgctgctgttcgtgcccgtcgtgttcggcttcgtgcacgcgtggctcgagcggcgt
cgcgacgcggcgggcgcgcgtggtgcgcttgatatgcgcgatgcgcccggtgcgcccgaa
gcccccgatacgccggcgctgcgttga

DBGET integrated database retrieval system