KEGG   Burkholderia vietnamiensis: Bcep1808_6429Help
Entry
Bcep1808_6429     CDS       T00493                                 

Definition
hypothetical protein (EC:2.6.1.-)
Organism
bvi  Burkholderia vietnamiensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:1020112..1021512
Genome map
AA seq 466 aa AA seqDB search
MNQAALIEADRQHLIHPVVNYRAHEARGVTVLESADGVFLRDGDGHTLLDAFSGLWCVNV
GYGRESIVKAAAEQMAKLPYATGYFHFGSQPAIELAERLAALAPPSLNRVYFTLGGSDAV
DSAVRFITHYFNATGRPSKKQMIALERGYHGSSSIGAGLTALPAFHRHFDLPRADQHHIP
SPYPYRHPLGDDPQALIAASVAALEAKVAALGADNVAAFFCEPIQGSGGVIVPPAGWLKA
MRDACRRLGILFVADEVITGFGRTGPLFACETESVEPDLMTVAKGLTAGYAPMGAVLMSD
EIYEGLAGSRTESAVVGHGHTYSAHPVSAAIGLEVLKLYHEGGLLANGRAQAPRFAAGLD
ALRAHPLVGDARSAGLLGALELVADKARKTRFDPALNVPDKIAAAAYANGVVFRAFGDGV
LGFAPALSFTAGEFDLMFERVRKTLDDVLADPGVQRALDAAHAQPA
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaagccgcgctgatcgaagccgatcgtcaacatctgatccatcccgtcgtcaac
tatcgtgcgcacgaagcgcgcggcgtcaccgtgctcgaatccgccgacggcgtgttcctg
cgcgatggcgacggccatacgctgctcgacgcgttctcgggcctgtggtgcgtgaacgtc
ggctacggccgcgagagcatcgtgaaggccgccgccgagcagatggcgaagctgccctac
gcgaccggctatttccatttcggctcgcagccggcgatcgaactcgccgaacggctcgcc
gcgctcgcgccgccgtcgctgaaccgcgtgtacttcacgctcggcggctcggacgcggtc
gactccgcggtgcgcttcatcacgcattacttcaacgcgaccggccgcccgtcgaagaag
cagatgatcgcgctcgagcgcggctatcacggctcgtcgtcgatcggcgccggcctgacc
gcgctgcccgcgttccaccgtcatttcgatctgccgcgcgccgatcagcaccatatcccg
tcgccctacccgtaccgccatccgctcggcgacgacccgcaggcgctgatcgccgcctcg
gtcgccgctctcgaggcgaaggtcgcggcgctcggcgccgacaacgtcgccgcgttcttc
tgcgagccgatccagggctcgggcggcgtgatcgtgccgccggcgggctggctgaaggcg
atgcgcgacgcgtgccggcgcctcggcatcctgttcgtcgccgacgaggtgatcacgggc
ttcggccgcaccggcccgctgttcgcgtgcgaaaccgaatccgtcgagccggacctgatg
accgtcgcgaaggggctcaccgccggctacgcgccgatgggcgcggtgctgatgtccgac
gaaatctacgaggggctcgccggcagccgtaccgaatcggccgtggtcggccatggtcat
acgtattccgcgcacccggtcagcgcggcgatcggcctcgaggtgctgaagctctatcac
gagggcgggctgctcgcgaacggccgcgcgcaggcgccgcgcttcgccgcggggctcgac
gcgctgcgcgcgcatccgctcgtcggcgacgcgcgctcagccggtctgctcggcgcgctc
gagctggtggccgacaaggcgcgcaagacgcgcttcgacccggcgctgaacgtgccggac
aagatcgccgcggccgcgtacgcgaacggcgtggtgtttcgcgcgttcggcgacggcgtg
ctcggcttcgcgccggcgctgagcttcaccgcgggagaattcgacctgatgttcgaacgc
gtgcgcaagacgctcgacgacgtgctggccgacccgggcgtgcaacgcgcgctcgacgcc
gcccacgcgcagccggcctga

DBGET integrated database retrieval system