KEGG   Burkholderia vietnamiensis: Bcep1808_6434Help
Entry
Bcep1808_6434     CDS       T00493                                 

Definition
beta strand repeat-containing protein
Organism
bvi  Burkholderia vietnamiensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:1027289..1029247
Genome map
AA seq 652 aa AA seqDB search
MIVSPRRFPLHVAALASALALAACGGGDDVASTPATSAAMPAPPADPGFVDSAPVPSVPA
FVDNIATNQRGDARYATLSTNAAVRVVSRFLDLWQPSTMIVDAGVNAPANGAFPAVVAST
CSGLPSSGTPCGTILNGTVLAANVQYVVDATTARTQQQADAAYFDDRRGKGYSVTDGMGP
LTDAWRTAAQQTTSITSVPADATTVLYNDAGNNTGVGSSTNANFGKVVDLLNEMGTNAST
EPSKRFYKYARPYRWSAAVAVAPTLVPAESATPATDGGFISGHEAEAMRDATTMAWLVPE
RFQEMVSRGLELGENRILAGMHSPLDVIGGRMLALAISAANLTAYASDAQAAYGQAHQAL
QQLTGTTDATFAAFAHSGTTATDRFADYTANRAAFLRRLTFGFGAIESTDAPPVVPKGAE
VLLQTRFPYLSADQRRVVLKTTELPSGYPVMDDAEGWGRLNLFTAADGYGTFNGNVVVSM
DASRGGFYAADQWRNDIGGAGKLTLQGTGTLTLAGNNSYTGGTQVNGGTLAAASASAFGN
GDVYVGAGGGVRIAAAAPVTIATRYTQLANTTLELDIDGKGGGRLRVGGPLTVAGGTLHV
KFVNGYAPKAGDTIALIDGAALAAKFATVTVDGFKATPVYTATGVSVVLSAS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtgtcaccccgccgttttccgctgcacgtcgcagcactcgcgagcgcgctcgca
ctggccgcctgcggcggcggcgacgacgtcgcatcgaccccggcgaccagcgccgcgatg
ccggcgccgcccgccgaccccggcttcgtcgacagcgcaccggtgccgagcgtgccggcg
ttcgtcgacaacatcgcgaccaaccagcgcggcgacgcgcgctatgcgacgttgtcgacc
aacgccgcggtgcgggtcgtgagccgcttcctcgatctgtggcagccgtcgacgatgatc
gtcgacgcgggcgtgaacgcgccggccaacggcgcgtttccggccgtggtggcgtcgacg
tgctccggcctgcccagcagcggcacgccgtgcggcacgattctgaacggcacggtgctc
gccgccaacgttcaatacgtggtcgacgcaacgaccgcacgcacgcagcagcaggccgat
gcggcctacttcgacgaccggcgcggcaaaggctacagcgtgaccgacgggatgggcccg
ctcaccgacgcgtggcgcacggccgcgcagcagacgaccagcatcaccagcgtgccggcc
gatgcgaccacggtgctgtacaacgacgccggcaacaacaccggcgtcggcagcagcacc
aacgcgaacttcggcaaggtcgtcgatctgctcaacgaaatgggcaccaacgcgtcgacc
gaaccgtcgaagcgcttctacaaatatgcgcgtccgtaccgctggagcgccgcggtcgcc
gtcgcgccgacgctcgtgcccgccgaaagcgcgacgcccgccaccgacggcggcttcatc
agcggccacgaggccgaagcgatgcgcgacgcgacgacgatggcgtggctcgtgccggag
cgcttccaggagatggtgagccgcggcctcgaactcggcgagaaccggatcctcgccggc
atgcattcgccgctcgacgtgatcggcggccgcatgctcgcgctcgccatcagcgcggcg
aacctgaccgcctacgcgagcgacgcgcaggccgcgtacggtcaggcgcatcaggcgctg
cagcagctcacgggaacgaccgacgcgacgttcgccgcgttcgcgcattcgggcaccacg
gcgaccgaccggttcgccgattacaccgcgaaccgggccgcgttcctgcgccgcctgacg
ttcggcttcggcgcgatcgaatcgaccgacgcgccgcccgtcgtgcccaagggcgccgag
gtgctgctgcagacgcgcttcccgtacctgagcgcggaccagcggcgggtcgtgctgaag
accaccgagctgccgtcgggctacccggtgatggacgatgcggaaggctggggccgcctg
aacctgttcaccgcggccgacggctacggcacgttcaacggcaacgtggtcgtgtcgatg
gacgcgtcgcgcggcggcttctacgcggccgaccagtggcgcaacgacatcggcggcgcc
ggcaagctgacgctgcaaggcaccggcacgctgacgctcgccggcaacaacagctacacg
ggcggcacgcaggtgaacggcggcacgctcgccgcggcgtccgcgagcgcgttcggcaac
ggcgacgtgtacgtcggcgcgggcggcggcgtccggatcgcggcggccgcgccggtcacg
atcgcgacgcgttacacgcagctcgcgaacacgacgctcgaactcgacatcgacggcaaa
ggcggcggccgcctgcgcgtcggcggcccgctcaccgtcgccggcggcacgcttcacgtg
aagttcgtgaacggctatgcgccgaaggccggcgacacgatcgcgctgatcgacggcgcg
gcgctcgccgcgaagttcgcgacggtgacggtcgacggcttcaaggcaacgccggtttat
acggctacgggcgtgtcggtggtgttgtcggcgtcctga

DBGET integrated database retrieval system