KEGG   Burkholderia vietnamiensis: Bcep1808_6453Help
Entry
Bcep1808_6453     CDS       T00493                                 

Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
bvi  Burkholderia vietnamiensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bvi00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bvi00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:1050484..1051572
Genome map
AA seq 362 aa AA seqDB search
MRIDTDTSHPATDVGRIPSEPWGTLPGGDPVRRYTLRNAHGVRVVVSDLGATVVSWLAPD
RTGRFADIVLAHDTPAEYLDAGAYLGATVGRWANRIAAGRFTLDGIDYPLDRNENGNLLH
GGASGFHRARWDVIDDRGGLTLRLESPEGDAGFPGNVRVQVRYTLDDDGTLTIDYTGVTD
APTPLNLTNHSYFNLSGRAGGDVRGHLLQIDADAFVEVDDALIPTGTADVTGSAFDFRQS
APIGARLDWPHAQLARGRGFDHCYVLREPGGGVRTVASIYDPESGRELAVSTDQRGLQLY
TGNYLQGLRVSGGVVCAPHAALCVEAGYFPDQVNMDGLREETILRPGQVYRQTTRYRVGV
RG
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatcgataccgacacttctcacccggcgaccgacgtcggccgcattccgtccgag
ccgtggggcacgctgcccggcggcgacccggtgcggcgctatacgctgcgcaatgcgcac
ggcgtgcgcgtcgtcgtcagcgatctcggcgcgaccgtcgtgtcgtggctcgcgccggat
cgcaccgggcgcttcgccgacatcgtgctcgcgcacgacacgccggccgagtatctcgac
gcgggcgcgtacctcggcgcgacggtcggccgctgggccaaccggatcgccgccgggcgc
ttcacgctcgacggcatcgactatccgctcgaccgcaacgagaacggcaacctgctgcat
ggcggcgcgagcggctttcatcgtgcgcgctgggacgtgatcgacgaccgcggcgggctg
acgctgcggctcgagtcgccggaaggcgatgcggggtttcccggcaacgtgcgcgtgcag
gtccgttacacgctcgacgacgacggcacgctgacgatcgactacacgggcgtgaccgat
gcgccgacgccgctgaacctgacgaatcacagctacttcaacctgagcggacgcgcgggc
ggcgacgtgcgcggacatctgctgcagatcgacgccgatgcgttcgtcgaagtggacgac
gcgctgatcccgaccggcacggccgacgtgacgggcagcgcgttcgatttccgccagagc
gcgccgatcggcgcgcgcctcgactggccgcatgcgcagctcgcgcgcgggcgcgggttc
gatcactgctacgtgttgcgcgaaccggggggcggcgtgcgcacggttgcgtcgatctac
gatccggagagcgggcgcgagctcgccgtgtcgaccgaccaacgcgggctgcagctttat
acgggcaactatctgcagggcttgcgcgtgagcggcggtgtggtgtgcgcgccgcatgcg
gcgctgtgcgtcgaggccgggtactttccggatcaggtcaatatggatgggttgcgcgaa
gagacgattctgcggccggggcaggtttatcggcagacgacgcggtatcgggtgggggtg
cgggggtag

DBGET integrated database retrieval system