KEGG   Burkholderia vietnamiensis G4: Bcep1808_6455Help
Entry
Bcep1808_6455     CDS       T00493                                 

Definition
(GenBank) Limonene-1,2-epoxide hydrolase
  KO
K10533  limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
bvi00903  Limonene and pinene degradation
Brite
KEGG Orthology (KO) [BR:bvi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Bcep1808_6455
Enzymes [BR:bvi01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     Bcep1808_6455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SnoaL_2 LEH SnoaL SnoaL_3 DUF4440
Motif
Other DBs
NCBI-ProteinID: ABO59352
JGI: Bcen18086455
UniProt: A4JSU9
Position
3:complement(1053451..1053825)
Genome map
AA seq 124 aa AA seqDB search
MSHDTKTLAEQVVRAFEARDIESMSALLADDVRLEDVPLGAHVGRHAVVEKITDFFGKAS
TYRWEQQRLIAQGSTAIVERTSHIVLGGKEIRLPMVVILEFDANGKLTLFKDYFDLQTLE
RQLA
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgagtcacgatacgaaaaccctcgccgagcaagtcgtccgcgcgttcgaggcgcgcgat
atcgagtcgatgtcggcgttgctcgccgacgacgtgcgcctcgaggacgtaccgctcggc
gcgcatgtcggcaggcatgccgtcgtcgagaagatcaccgacttcttcggcaaggcaagc
acctatcgctgggagcagcagcgcttgatcgcacagggcagcaccgcgatcgtcgagcgc
acgagccatatcgtgctgggcggcaaggagattcggttgccgatggtggtgattctggag
ttcgacgcaaacggcaagttgacgctcttcaaggactatttcgatctgcagacgctggag
cggcaactcgcatga

DBGET integrated database retrieval system