KEGG   Burkholderia vietnamiensis: Bcep1808_6474Help
Entry
Bcep1808_6474     CDS       T00493                                 

Definition
type II and III secretion system protein
Orthology
K02280  
pilus assembly protein CpaC
Organism
bvi  Burkholderia vietnamiensis
Brite
Secretion system [BR:bvi02044]
 Type II secretion system
  Tight adherence (Tad) export apparatus
   Bcep1808_6474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:complement(1072372..1074315)
Genome map
AA seq 647 aa AA seqDB search
MKINPQHSGTGPVRTRIARGAMMAAILCTGTLTVYSALAQEAAESAALTKGGASAPAAVA
KGPMQMTISMAPAIAAAPAAAAGPLRGPNCVGAVRDSTSVSVPLGKSLLVPMPEAVRNRT
IGNPAVAQATMVSPQTLYILGLSVGTTNMIVQGKSGACRVIDVAVGADAGGLQASLLQLM
PAERDIHVSTAAGTIVLAGTVSNSQAAQQAVQIARAYSDSAGGGEGGTAKGGGVLNMLSV
TSPQQVMLEVKVAEVSKTLINQMGSALNIQGGFGSWSGALVSNLLAGVASAAVFNKANNK
PFSIAADAQNTDNLVKILAEPNLVTISGQEATFLAGGKIFIPVPQSSGTGVSTITLQQEE
FGVALKFTPTVLANGRISLKVAPEVSELSQTGVTLSATNIGGTSILPLITTRRASTTVQM
SDGESFAIGGLIKDNATGALKAIPGVGEVPVLGALFRSTSFQQDRTELIFLITPHLVKPL
QSADQPMPTDSFSKPNEADVYATGNMEGRHGVRRPAAQPANGAADAPQAPAPTPAQQSAA
PAAAAPAPRAPAPADAPAPAAVQPENAAAAAPAAAGAVSAAPAVAQPPADAANAANAANA
ARVARIEAAAARLAAAAGNTPPQKPRLPAAAHAQVARANAGPQSTDR
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcaatccgcaacactcaggtaccggcccggtgcgcacacgtatcgcacgaggc
gcgatgatggccgcgatcctctgtaccggaacgctgacggtatacagcgcactggcgcag
gaagccgccgaatcggcggccttgacgaagggcggcgcgagcgcgccggccgccgtcgcg
aagggaccgatgcagatgacgatcagcatggcgccggcgatcgccgccgcgccggccgcg
gctgccgggccgctgcgcgggccgaactgcgtgggcgcggtgcgcgattcgaccagcgtc
agcgtgccgctcggcaagtcgttgctggtgccgatgccggaggcagtccgcaatcgcacc
atcggcaatccggccgttgcgcaggcaaccatggtatcgccacagacgctctacatcctc
gggctgtcggtcggcacgaccaacatgatcgtgcagggcaagagcggcgcgtgccgcgtg
atcgacgtggcggtcggcgctgatgcgggcggcctgcaggcgtcgctgctgcaactgatg
ccggccgagcgcgacattcacgtatcgaccgcggccggcacgatcgtgctggcgggcacc
gtgtcgaactcgcaggccgcgcagcaggccgtgcagatcgcgcgcgcctacagcgacagc
gccggcggcggcgaaggcgggacggccaagggcggcggcgtgctcaacatgctgtccgtc
acgtcgccgcagcaggtgatgctcgaggtcaaggtggccgaggtgtcgaagacgctgatc
aaccagatgggcagcgcgctgaacatccagggcggcttcggctcgtggagcggcgcgctg
gtcagcaacctgctcgccggcgtcgcgagcgccgcggtgttcaacaaggcgaacaacaag
ccgttcagcatcgcggccgacgcgcagaacaccgacaacctcgtgaagatcctcgccgag
ccgaacctcgtgacgatcagcggccaggaggcgacgttcctcgctggcggcaagatcttc
atcccggtgccgcaaagcagcggtaccggcgtgtcgacgatcacgctgcagcaggaggaa
ttcggcgtcgcgctgaagttcacgccgacggtgctcgcgaacggccgcatcagcctgaag
gtcgcgccggaagtgtcggagctgtcgcaaaccggcgtcacgctgagcgcgaccaacatc
ggcggcacgtcgatcctgccgctcatcacgacgcggcgtgcctcgacgacggtccagatg
agcgacggcgagtcgttcgcgatcggcgggctcatcaaggacaacgccaccggcgccctc
aaggcgatcccaggcgtcggcgaagtgccggtgctcggcgcgctgttccgcagcacgtcg
ttccagcaggaccgcaccgagctgatcttcctgatcacgccgcacctggtgaagccgctg
cagagcgccgaccagccgatgccgaccgacagcttctcgaagccgaacgaagccgacgtg
tacgcaaccggcaacatggaaggccgccacggcgtgcgccggccggccgcgcaaccggcg
aacggcgccgcggatgcgccgcaggcaccggcgcccacgcccgcgcagcaatcggctgcg
ccggcggcggccgcgcccgcaccgcgtgccccggcgcctgccgacgcaccggcgcctgcc
gcggtccagccggagaacgcggcggcagccgcaccggctgcggccggtgcggtgagcgcg
gcgccggccgtcgcgcagccgccggccgatgcggccaacgcagccaacgcagccaacgca
gcccgtgtcgcacgcatcgaagccgccgccgcgcgtctcgcggcggccgcgggcaacacg
ccgccccagaagccccggctgccagccgccgcccacgcgcaggtcgcgcgggcgaacgca
ggcccccagtccaccgatcgttga

  All links  
No link information was found.   
DBGET integrated database retrieval system