KEGG   Burkholderia vietnamiensis: Bcep1808_6474Help
Entry
Bcep1808_6474     CDS       T00493                                 

Definition
type II and III secretion system protein
Orthology
K02280  
pilus assembly protein CpaC
Organism
bvi  Burkholderia vietnamiensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:complement(1072372..1074315)
Genome map
AA seq 647 aa AA seqDB search
MKINPQHSGTGPVRTRIARGAMMAAILCTGTLTVYSALAQEAAESAALTKGGASAPAAVA
KGPMQMTISMAPAIAAAPAAAAGPLRGPNCVGAVRDSTSVSVPLGKSLLVPMPEAVRNRT
IGNPAVAQATMVSPQTLYILGLSVGTTNMIVQGKSGACRVIDVAVGADAGGLQASLLQLM
PAERDIHVSTAAGTIVLAGTVSNSQAAQQAVQIARAYSDSAGGGEGGTAKGGGVLNMLSV
TSPQQVMLEVKVAEVSKTLINQMGSALNIQGGFGSWSGALVSNLLAGVASAAVFNKANNK
PFSIAADAQNTDNLVKILAEPNLVTISGQEATFLAGGKIFIPVPQSSGTGVSTITLQQEE
FGVALKFTPTVLANGRISLKVAPEVSELSQTGVTLSATNIGGTSILPLITTRRASTTVQM
SDGESFAIGGLIKDNATGALKAIPGVGEVPVLGALFRSTSFQQDRTELIFLITPHLVKPL
QSADQPMPTDSFSKPNEADVYATGNMEGRHGVRRPAAQPANGAADAPQAPAPTPAQQSAA
PAAAAPAPRAPAPADAPAPAAVQPENAAAAAPAAAGAVSAAPAVAQPPADAANAANAANA
ARVARIEAAAARLAAAAGNTPPQKPRLPAAAHAQVARANAGPQSTDR
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcaatccgcaacactcaggtaccggcccggtgcgcacacgtatcgcacgaggc
gcgatgatggccgcgatcctctgtaccggaacgctgacggtatacagcgcactggcgcag
gaagccgccgaatcggcggccttgacgaagggcggcgcgagcgcgccggccgccgtcgcg
aagggaccgatgcagatgacgatcagcatggcgccggcgatcgccgccgcgccggccgcg
gctgccgggccgctgcgcgggccgaactgcgtgggcgcggtgcgcgattcgaccagcgtc
agcgtgccgctcggcaagtcgttgctggtgccgatgccggaggcagtccgcaatcgcacc
atcggcaatccggccgttgcgcaggcaaccatggtatcgccacagacgctctacatcctc
gggctgtcggtcggcacgaccaacatgatcgtgcagggcaagagcggcgcgtgccgcgtg
atcgacgtggcggtcggcgctgatgcgggcggcctgcaggcgtcgctgctgcaactgatg
ccggccgagcgcgacattcacgtatcgaccgcggccggcacgatcgtgctggcgggcacc
gtgtcgaactcgcaggccgcgcagcaggccgtgcagatcgcgcgcgcctacagcgacagc
gccggcggcggcgaaggcgggacggccaagggcggcggcgtgctcaacatgctgtccgtc
acgtcgccgcagcaggtgatgctcgaggtcaaggtggccgaggtgtcgaagacgctgatc
aaccagatgggcagcgcgctgaacatccagggcggcttcggctcgtggagcggcgcgctg
gtcagcaacctgctcgccggcgtcgcgagcgccgcggtgttcaacaaggcgaacaacaag
ccgttcagcatcgcggccgacgcgcagaacaccgacaacctcgtgaagatcctcgccgag
ccgaacctcgtgacgatcagcggccaggaggcgacgttcctcgctggcggcaagatcttc
atcccggtgccgcaaagcagcggtaccggcgtgtcgacgatcacgctgcagcaggaggaa
ttcggcgtcgcgctgaagttcacgccgacggtgctcgcgaacggccgcatcagcctgaag
gtcgcgccggaagtgtcggagctgtcgcaaaccggcgtcacgctgagcgcgaccaacatc
ggcggcacgtcgatcctgccgctcatcacgacgcggcgtgcctcgacgacggtccagatg
agcgacggcgagtcgttcgcgatcggcgggctcatcaaggacaacgccaccggcgccctc
aaggcgatcccaggcgtcggcgaagtgccggtgctcggcgcgctgttccgcagcacgtcg
ttccagcaggaccgcaccgagctgatcttcctgatcacgccgcacctggtgaagccgctg
cagagcgccgaccagccgatgccgaccgacagcttctcgaagccgaacgaagccgacgtg
tacgcaaccggcaacatggaaggccgccacggcgtgcgccggccggccgcgcaaccggcg
aacggcgccgcggatgcgccgcaggcaccggcgcccacgcccgcgcagcaatcggctgcg
ccggcggcggccgcgcccgcaccgcgtgccccggcgcctgccgacgcaccggcgcctgcc
gcggtccagccggagaacgcggcggcagccgcaccggctgcggccggtgcggtgagcgcg
gcgccggccgtcgcgcagccgccggccgatgcggccaacgcagccaacgcagccaacgca
gcccgtgtcgcacgcatcgaagccgccgccgcgcgtctcgcggcggccgcgggcaacacg
ccgccccagaagccccggctgccagccgccgcccacgcgcaggtcgcgcgggcgaacgca
ggcccccagtccaccgatcgttga

DBGET integrated database retrieval system