KEGG   Burkholderia vietnamiensis: Bcep1808_6508Help
Entry
Bcep1808_6508     CDS       T00493                                 

Definition
(RefSeq) UDP-glucose pyrophosphorylase (EC:2.7.7.9)
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bvi  Burkholderia vietnamiensis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bvi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Bcep1808_6508
   00052 Galactose metabolism
    Bcep1808_6508
   00500 Starch and sucrose metabolism
    Bcep1808_6508
   00520 Amino sugar and nucleotide sugar metabolism
    Bcep1808_6508
Enzymes [BR:bvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Bcep1808_6508
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:1118388..1119272
Genome map
AA seq 294 aa AA seqDB search
MLKVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAIEAGITEMIFVTGRS
KRAIEDHFDKSYEIEAELEARGKEKLLSLVRSIKPSHVDCFYVRQAEALGLGHAVLCAEK
LVGDNPFAVILADDLLDGPTPVLRQMIDVFDHYHASVIGVEEIAPADSKSYGVIDGKRWE
DDLFKLSGIVEKPEPAQAPSNFGVVGRYVLKPKIFKHLRGLKPGAGGELQLTDAIQSLLT
DEQVLAYRYDGTRFDCGSKLGYLKATVEFALRHPEVAADFERYLLARMSEQLVV
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaagtgacgaaagccgtctttccggtcgccggcctgggcacgcggttcctgccc
gccaccaaggcgagccccaaggaaatgttgccggtcgtggacaagccgttgatccagtat
gccgtcgaagaggcgatcgaagcgggcatcaccgagatgatcttcgtgaccgggcgcagc
aagcgcgcgatcgaagatcacttcgacaagtcgtacgagatcgaggccgaactcgaggca
cgcggcaaggagaagctgctgtcgctcgtgcgcagcatcaagccgagccacgtcgactgc
ttctacgttcgccaggccgaagcgctcgggctcggtcacgccgtcctgtgcgcggagaag
ctcgtcggcgacaacccgttcgccgtgattctcgccgacgacctgctcgacggcccgacg
cccgttctgcgccagatgatcgacgtattcgaccactatcatgcgtcggtcatcggcgtc
gaggagatcgcgccggcggattcgaagtcctatggcgtgatcgacggcaagcgctgggaa
gacgatctcttcaagctgtcggggatcgtcgagaagcccgaaccggcgcaggcgccgtcg
aatttcggcgtcgtgggccgttatgtgctgaagccgaagatcttcaagcatctgcgcggg
ctcaagccgggcgcgggcggtgaactgcagctgaccgacgcgatccagtcgctgctcacc
gatgaacaggtgctcgcgtaccgctacgacggcacgcgcttcgactgcggcagcaagctc
ggctacctgaaggcgacggtcgaatttgcgttgcggcatccggaggtcgcggcggatttc
gaacggtatctgctcgcgcggatgtcggagcagttggtcgtctga

DBGET integrated database retrieval system