KEGG   Burkholderia vietnamiensis G4: Bcep1808_6508Help
Entry
Bcep1808_6508     CDS       T00493                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
bvi00040  Pentose and glucuronate interconversions
bvi00052  Galactose metabolism
bvi00500  Starch and sucrose metabolism
bvi00520  Amino sugar and nucleotide sugar metabolism
bvi01100  Metabolic pathways
bvi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bvi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Bcep1808_6508
   00052 Galactose metabolism
    Bcep1808_6508
   00500 Starch and sucrose metabolism
    Bcep1808_6508
   00520 Amino sugar and nucleotide sugar metabolism
    Bcep1808_6508
Enzymes [BR:bvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Bcep1808_6508
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ABO59405
JGI: Bcen18086508
UniProt: A4JT02
Structure
PDB: 

Jmol
Position
3:1118388..1119272
Genome map
AA seq 294 aa AA seqDB search
MLKVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAIEAGITEMIFVTGRS
KRAIEDHFDKSYEIEAELEARGKEKLLSLVRSIKPSHVDCFYVRQAEALGLGHAVLCAEK
LVGDNPFAVILADDLLDGPTPVLRQMIDVFDHYHASVIGVEEIAPADSKSYGVIDGKRWE
DDLFKLSGIVEKPEPAQAPSNFGVVGRYVLKPKIFKHLRGLKPGAGGELQLTDAIQSLLT
DEQVLAYRYDGTRFDCGSKLGYLKATVEFALRHPEVAADFERYLLARMSEQLVV
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaagtgacgaaagccgtctttccggtcgccggcctgggcacgcggttcctgccc
gccaccaaggcgagccccaaggaaatgttgccggtcgtggacaagccgttgatccagtat
gccgtcgaagaggcgatcgaagcgggcatcaccgagatgatcttcgtgaccgggcgcagc
aagcgcgcgatcgaagatcacttcgacaagtcgtacgagatcgaggccgaactcgaggca
cgcggcaaggagaagctgctgtcgctcgtgcgcagcatcaagccgagccacgtcgactgc
ttctacgttcgccaggccgaagcgctcgggctcggtcacgccgtcctgtgcgcggagaag
ctcgtcggcgacaacccgttcgccgtgattctcgccgacgacctgctcgacggcccgacg
cccgttctgcgccagatgatcgacgtattcgaccactatcatgcgtcggtcatcggcgtc
gaggagatcgcgccggcggattcgaagtcctatggcgtgatcgacggcaagcgctgggaa
gacgatctcttcaagctgtcggggatcgtcgagaagcccgaaccggcgcaggcgccgtcg
aatttcggcgtcgtgggccgttatgtgctgaagccgaagatcttcaagcatctgcgcggg
ctcaagccgggcgcgggcggtgaactgcagctgaccgacgcgatccagtcgctgctcacc
gatgaacaggtgctcgcgtaccgctacgacggcacgcgcttcgactgcggcagcaagctc
ggctacctgaaggcgacggtcgaatttgcgttgcggcatccggaggtcgcggcggatttc
gaacggtatctgctcgcgcggatgtcggagcagttggtcgtctga

DBGET integrated database retrieval system