KEGG   Burkholderia vietnamiensis: Bcep1808_6794Help
Entry
Bcep1808_6794     CDS       T00493                                 

Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
bvi  Burkholderia vietnamiensis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bvi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bcep1808_6794
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bcep1808_6794
   00630 Glyoxylate and dicarboxylate metabolism
    Bcep1808_6794
Enzymes [BR:bvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Bcep1808_6794
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pBVIE01:192467..194635
Genome map
AA seq 722 aa AA seqDB search
MPHMTQRGGLQVAANLEHFIETEALPGTGVDSAAFWAGFDAIVHDLAPKNRALLAERDRL
QVELDKWHRANPGPVRDLRAYRSFLESIGYIVPSPAAVQATTENVDREIAEQAGPQLVVP
LSNQRYALNAANARWGSLYDALYGTDAIDETDGAERTAKFNPVRGARVIAFARKFLDDAA
PLANASHKDATGYRVENGKLVVTLNNGTTGLQDAAQFIGYQGDAGAPSTLLFKHNGLHFE
IQIDANDPIGKTDPAHVKDVLMEAAVSTIIDCEDSVAAVDADDKVQLYRNWLGLMLGNLT
EEVTKGGKTFTRRLNADREYQGANGQPVKLHGRSLLFIRNVGHLMTNPAVLDRDGNEIPE
GILDGVVTTLCALHDRTHKLNSRTGSIYIVKPKMHGPAEVAFASELFSRVEDLLGLARNT
IKMGIMDEERRTSVNLAACIGQASSRVAFINTGFLDRTGDEMHSSMEAGPMMRKGDMKSS
KWIAAYERSNVLVGLAAGLRGRAQIGKGMWAMPDLMKAMLEQKIGHPKAGANTAWVPSPT
AATLHALHYHQVNVQAVQKELERTDFASVRDELLEGLLTIPVVERAQWSDEEIRSEVENN
AQGILGYVVRWIDQGVGCSKVPDIHNVGLMEDRATLRISSQHIANWLRHGVVKPEFLKET
FERMAKVVDQQNAGDPSYQPMAGNFDSSIAYKAATALVFEGCAQPSGYTEPLLHSFRLQR
KA
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgcctcacatgacccaacgcggcggattgcaggtcgccgcgaacctcgaacatttcatt
gaaacagaagccctgcccggcaccggcgtcgatagcgccgcgttctgggccggtttcgat
gcaatcgtgcacgaccttgcgcccaaaaaccgcgcactgctcgccgaacgcgaccgcctg
caggtcgaactcgacaaatggcatcgggcgaatcccggcccggtgcgcgatctgcgcgcg
taccgcagcttcctcgaaagcatcggctatatcgtgccgtcgcccgcggcggtgcaggcg
acgacggagaacgtcgaccgcgaaatcgccgaacaggccggcccgcagctcgtcgtgccg
ctgtcgaaccagcgctatgcgctgaacgcggcaaacgcacgctggggcagcctgtacgac
gcgctgtacggtaccgacgccatcgacgaaacagacggcgccgaacgcacggcaaagttc
aatccggtgcgcggcgcgcgcgtgatcgcgttcgcgcgcaagttcctcgacgacgccgcg
ccgctcgcaaacgcgtcgcataaggacgcaaccgggtatcgcgtggaaaacggcaagctg
gtcgtcacgctgaacaacggcacgacaggcctgcaggacgccgcgcagttcatcggctat
cagggcgatgcgggcgcgccgtcgacgctgctcttcaaacacaacggcctgcacttcgaa
atccagatcgacgcgaacgatccgatcggcaagaccgaccccgcgcacgtcaaggacgtg
ctgatggaagcagccgtcagcacgatcatcgattgcgaagactcggtcgccgccgtcgat
gccgacgacaaggttcagctctaccgcaactggctcggcctgatgctcggcaatctgacg
gaagaagtcacgaagggcggcaagacattcacgcgccgcctgaacgcggaccgcgaatat
caaggcgcgaacggccaacctgtgaagctgcatggccgctcgctgctgttcatccgcaac
gtcggccatctgatgacgaacccggccgtgctcgaccgcgacggcaacgagattcccgaa
ggcattctcgacggcgtcgtcacgacgctatgcgcgctgcacgaccgcacgcacaagctc
aattcgcgcacgggctcgatctacatcgtcaagccgaagatgcacggtcccgccgaagtc
gcgttcgcgagcgagctgttctcgcgcgtcgaagatctgctcggcctcgcgcgcaacacg
atcaagatgggcatcatggacgaggagcgccgcaccagcgtgaacctcgccgcgtgtatc
ggccaggcttcgtcgcgcgtcgcgttcatcaacacgggcttcctcgaccgtacgggcgac
gagatgcacagctcgatggaagcgggcccgatgatgcgcaagggcgatatgaagtcgagc
aagtggatcgccgcctatgagcgcagcaacgtgctcgtcggcctcgctgcggggctgcgc
ggccgcgcgcagatcggcaagggcatgtgggcgatgcccgacctgatgaaagcgatgctc
gaacagaagatcggccatccgaaggcaggtgcgaacactgcatgggtgccctcgcccacg
gccgcgacgctgcacgcgctgcattatcaccaggtcaacgtgcaggcggtgcagaaggaa
ctcgagcgcaccgacttcgcgagcgtgcgcgacgaactgctggaggggctgctgacgatt
cccgtcgtcgagcgcgcgcaatggagcgacgaggagattcgcagcgaagtcgagaacaac
gcgcagggcattctcggctatgtggtgcggtggatcgatcagggcgtgggttgttcgaag
gtgccggacattcacaacgtcggcctgatggaagaccgcgcgacgctgcgcatttcgagc
cagcacatcgcgaactggctgcgtcacggcgtcgtcaagccggagttcctcaaggaaacg
ttcgagcgtatggcgaaggtcgtcgatcagcagaatgccggcgaccccagctaccagccg
atggcaggcaacttcgacagctcgatcgcatataaggcagcgactgcactggtgttcgaa
ggttgcgcgcaaccgagcggttatacggaaccgctgctgcactcattccgtttgcagcga
aaggcataa

DBGET integrated database retrieval system