KEGG   Burkholderia vietnamiensis: Bcep1808_6794Help
Entry
Bcep1808_6794     CDS       T00493                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
bvi  Burkholderia vietnamiensis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:bvi01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bvi00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:bvi00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pBVIE01:192467..194635
Genome map
AA seq 722 aa AA seqDB search
MPHMTQRGGLQVAANLEHFIETEALPGTGVDSAAFWAGFDAIVHDLAPKNRALLAERDRL
QVELDKWHRANPGPVRDLRAYRSFLESIGYIVPSPAAVQATTENVDREIAEQAGPQLVVP
LSNQRYALNAANARWGSLYDALYGTDAIDETDGAERTAKFNPVRGARVIAFARKFLDDAA
PLANASHKDATGYRVENGKLVVTLNNGTTGLQDAAQFIGYQGDAGAPSTLLFKHNGLHFE
IQIDANDPIGKTDPAHVKDVLMEAAVSTIIDCEDSVAAVDADDKVQLYRNWLGLMLGNLT
EEVTKGGKTFTRRLNADREYQGANGQPVKLHGRSLLFIRNVGHLMTNPAVLDRDGNEIPE
GILDGVVTTLCALHDRTHKLNSRTGSIYIVKPKMHGPAEVAFASELFSRVEDLLGLARNT
IKMGIMDEERRTSVNLAACIGQASSRVAFINTGFLDRTGDEMHSSMEAGPMMRKGDMKSS
KWIAAYERSNVLVGLAAGLRGRAQIGKGMWAMPDLMKAMLEQKIGHPKAGANTAWVPSPT
AATLHALHYHQVNVQAVQKELERTDFASVRDELLEGLLTIPVVERAQWSDEEIRSEVENN
AQGILGYVVRWIDQGVGCSKVPDIHNVGLMEDRATLRISSQHIANWLRHGVVKPEFLKET
FERMAKVVDQQNAGDPSYQPMAGNFDSSIAYKAATALVFEGCAQPSGYTEPLLHSFRLQR
KA
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgcctcacatgacccaacgcggcggattgcaggtcgccgcgaacctcgaacatttcatt
gaaacagaagccctgcccggcaccggcgtcgatagcgccgcgttctgggccggtttcgat
gcaatcgtgcacgaccttgcgcccaaaaaccgcgcactgctcgccgaacgcgaccgcctg
caggtcgaactcgacaaatggcatcgggcgaatcccggcccggtgcgcgatctgcgcgcg
taccgcagcttcctcgaaagcatcggctatatcgtgccgtcgcccgcggcggtgcaggcg
acgacggagaacgtcgaccgcgaaatcgccgaacaggccggcccgcagctcgtcgtgccg
ctgtcgaaccagcgctatgcgctgaacgcggcaaacgcacgctggggcagcctgtacgac
gcgctgtacggtaccgacgccatcgacgaaacagacggcgccgaacgcacggcaaagttc
aatccggtgcgcggcgcgcgcgtgatcgcgttcgcgcgcaagttcctcgacgacgccgcg
ccgctcgcaaacgcgtcgcataaggacgcaaccgggtatcgcgtggaaaacggcaagctg
gtcgtcacgctgaacaacggcacgacaggcctgcaggacgccgcgcagttcatcggctat
cagggcgatgcgggcgcgccgtcgacgctgctcttcaaacacaacggcctgcacttcgaa
atccagatcgacgcgaacgatccgatcggcaagaccgaccccgcgcacgtcaaggacgtg
ctgatggaagcagccgtcagcacgatcatcgattgcgaagactcggtcgccgccgtcgat
gccgacgacaaggttcagctctaccgcaactggctcggcctgatgctcggcaatctgacg
gaagaagtcacgaagggcggcaagacattcacgcgccgcctgaacgcggaccgcgaatat
caaggcgcgaacggccaacctgtgaagctgcatggccgctcgctgctgttcatccgcaac
gtcggccatctgatgacgaacccggccgtgctcgaccgcgacggcaacgagattcccgaa
ggcattctcgacggcgtcgtcacgacgctatgcgcgctgcacgaccgcacgcacaagctc
aattcgcgcacgggctcgatctacatcgtcaagccgaagatgcacggtcccgccgaagtc
gcgttcgcgagcgagctgttctcgcgcgtcgaagatctgctcggcctcgcgcgcaacacg
atcaagatgggcatcatggacgaggagcgccgcaccagcgtgaacctcgccgcgtgtatc
ggccaggcttcgtcgcgcgtcgcgttcatcaacacgggcttcctcgaccgtacgggcgac
gagatgcacagctcgatggaagcgggcccgatgatgcgcaagggcgatatgaagtcgagc
aagtggatcgccgcctatgagcgcagcaacgtgctcgtcggcctcgctgcggggctgcgc
ggccgcgcgcagatcggcaagggcatgtgggcgatgcccgacctgatgaaagcgatgctc
gaacagaagatcggccatccgaaggcaggtgcgaacactgcatgggtgccctcgcccacg
gccgcgacgctgcacgcgctgcattatcaccaggtcaacgtgcaggcggtgcagaaggaa
ctcgagcgcaccgacttcgcgagcgtgcgcgacgaactgctggaggggctgctgacgatt
cccgtcgtcgagcgcgcgcaatggagcgacgaggagattcgcagcgaagtcgagaacaac
gcgcagggcattctcggctatgtggtgcggtggatcgatcagggcgtgggttgttcgaag
gtgccggacattcacaacgtcggcctgatggaagaccgcgcgacgctgcgcatttcgagc
cagcacatcgcgaactggctgcgtcacggcgtcgtcaagccggagttcctcaaggaaacg
ttcgagcgtatggcgaaggtcgtcgatcagcagaatgccggcgaccccagctaccagccg
atggcaggcaacttcgacagctcgatcgcatataaggcagcgactgcactggtgttcgaa
ggttgcgcgcaaccgagcggttatacggaaccgctgctgcactcattccgtttgcagcga
aaggcataa

DBGET integrated database retrieval system