KEGG   Burkholderia vietnamiensis: Bcep1808_6911Help
Entry
Bcep1808_6911     CDS       T00493                                 

Definition
hypothetical protein
Organism
bvi  Burkholderia vietnamiensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pBVIE01:299382..300497
Genome map
AA seq 371 aa AA seqDB search
MMKVKTIGKLALATGAAMLVSSTPAHAQFMGVFQAAMSVVNQATGKLGSKIMGADKPSDL
EAERAKFFNAVETQTTGMDKASKAAFQAQLNNQWGSMENALLMRNAQLQHEKSAPLIDLK
KVAQDAMGGMAVQMNISSITGGAGGIGDLMQGAAMNGIVSGVNGQPQGANQYARPVYHNG
TMADAVTGGLTNVAGTAVSGAVSGAVKSAVDNVGGVFGNSTSGDYEITEGNDPAVFFGKA
PAELSARDLYRENGNLGWKRLDGSVAGAEAYAPIAGDEVAKAAVFNFDPATGQIKAAFRV
LKATQVDFKKVVDAVSKKYQSQPRFASQGSVLRAVWENGMFVAADSTKVSAGWSSLVNST
YQKATPAVAMN
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaggtgaagaccatcggcaagctggcactggcaacgggcgcagccatgctggtt
tccagcacaccggcgcacgcgcagttcatgggtgtgtttcaggcagcaatgtcggtcgtc
aatcaggcgacgggcaagctgggcagcaagatcatgggcgccgacaagcctagtgacctg
gaagccgaacgcgcgaagtttttcaacgcggtcgaaacgcagaccaccgggatggacaag
gcatcgaaggctgcatttcaggcgcagttgaataaccagtgggggtcgatggaaaacgcg
cttctgatgcgcaacgcgcaactccagcacgagaaatcggcgccgctcattgatctgaag
aaggttgcccaggacgcgatgggtggcatggctgtccagatgaacatcagctcgatcacc
ggcggcgcgggcggcatcggcgatctcatgcaaggcgcggcaatgaacggaatcgtctcg
ggtgtaaatggccagccgcagggcgcaaatcaatatgcgcgtcccgtctatcacaacggc
acgatggctgatgctgtcacgggtggcctgacgaatgtcgcgggaacggccgtttcgggt
gctgtgtcgggcgctgtgaagtccgctgtcgataatgtcggtggcgtattcggcaacagc
acttcgggcgactacgagatcaccgagggcaatgacccggcagttttctttggcaaggcg
ccggccgagctcagcgcgagggatctctatcgcgaaaacggcaatctggggtggaagcgc
ctcgacggatcggtggcgggcgcggaagcatatgcacccatcgcgggtgacgaagtcgca
aaggccgccgttttcaacttcgatcctgcgaccggacagatcaaagcggcgttccgtgtt
ctgaaggcgacacaggtcgacttcaaaaaggtggtcgacgcggtttcgaagaaatatcag
tctcagccccgattcgccagccagggctcggtcttgcgcgcggtgtgggagaacggcatg
ttcgtcgctgctgactcgacgaaggtttcagcaggctggtcgagtctcgtgaactctacc
tatcagaaggcgacgccagccgtagccatgaactga

DBGET integrated database retrieval system