KEGG   Burkholderia vietnamiensis: Bcep1808_6998Help
Entry
Bcep1808_6998     CDS       T00493                                 

Definition
autotransporter beta-domain-containing protein
Organism
bvi  Burkholderia vietnamiensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pBVIE01:complement(369909..372191)
Genome map
AA seq 760 aa AA seqDB search
MYHVDNELIPEEELMHRRNQPNFAPRLTVFGAAMYLALHAMSVNAAGVDVYAPSLGGTTM
DYDSQMGGSSDGDTLVGTQKNTTTGITAAYRWTLLGGKQYLGALNGGANSTANAANADAS
VIVGSANDGVSTDTSAYRWDSTNGMVRLADLNGGNYSIAKGVSADGQVIVGDSADGAAAG
AVSAVAWNVGAGTVRALGNLNGGTTSSANAVSADGNVAVGSALDGLTGNTDAVRWIGTAG
AQSLGHLSGGNNSVATAVSSDGAAIAGYSDSSSGSQAFLYRDVTGMQGLGYLSGGTFSKA
FGVSANGAVVVGDADTGGATTGFRWTYEKGMQALIDWLHDNDATYTLLPGNSLDHAYGVS
GDGNTVFGVGTLNGRAQPFVARTYGAIAQPVIPSAPPTTPTTPPSGGTSGGSSGTTGGTT
GANTGSTAGGTSSGGTTAAGGSGAGSHDAAQVGVIGLFDLGDSLHNASLYGQAMQSVVQG
FLQGGMHCDTFDLRGICVSTGALYSHNAGEVSGSNWQGDFSIAYRFSPNWVAGFGYQGPS
YKLEVGNDTVRSRADTFGAFVEYGNRLRQGAFARAAIAYQQGDATVNRSYLTGSGLDNSQ
GETAIGQRAVSTQAGYVFVVKNMAVMPYVGVDYLRTTIDGYTETTGQFPVRFNGRDEDNV
YGTVGVNGHLNIAGKAIVSAGLKHVQRLNKNNDPVSGDVLGLGSFSINQDTTEHWNEVAV
GVQFAGPAKASRVNIGYGHRFASGTSVARDIASVSFTMGF
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atgtatcacgtcgataacgaactgattcccgaggaagaactgatgcatcgtcgcaaccaa
cccaacttcgcgccccgactgaccgttttcggtgctgccatgtacctcgccctgcacgcc
atgagcgtcaatgctgcgggcgtcgacgtttatgcgccctcgctgggcggcacaacgatg
gactacgattcccagatgggcggatcgtcggatggcgacacgctcgtgggcacgcagaag
aacacgactaccgggatcacggccgcctaccgttggaccctgctcggcggcaagcaatat
ctcggcgccctcaatggcggggcaaactcgacggcgaacgcggcaaacgcggatgcgagc
gtgatcgtgggctcggcaaacgacggtgtgagcacggacacctccgcatatcgatgggac
agcacaaacggcatggtccgcttggcggacctgaacggcggcaactactccatcgcgaag
ggcgtctcggctgacggtcaggtgatcgtcggcgattccgcggatggtgcggcggccggg
gcggtgagcgctgtcgcctggaacgtcggcgctggcacagtccgcgcgctgggcaatctc
aacggtggcacaaccagcagcgcgaatgcggtatcagccgacggcaatgttgcggtgggc
agcgcgctcgatgggctgacgggtaacacagacgccgtacgctggatcggaacggccggc
gcacaaagcctcggtcacctgagcggcggcaacaactcggtcgccacggcggtgagctcc
gatggcgcggcgatcgctggatatagcgacagcagcagcggctcgcaggcattcctgtat
cgcgatgtgacgggcatgcaaggtctcggctatctaagcggcggcacgttctccaaggcc
ttcggggtttccgcgaacggtgcggtggtcgttggcgacgcagatacgggcggcgcaacg
acgggctttcgctggacgtacgagaaaggtatgcaggcgctgatcgactggctgcacgat
aacgacgcgacctataccctgctgcccggcaactcgctcgatcacgcgtatggcgtgtcg
ggcgacggcaacaccgttttcggcgtgggcaccttgaacggccgcgctcaaccgttcgtc
gcgcgcacctacggcgcgatcgctcagcccgtcatcccgagtgctccgccgactacaccg
acgacgcccccgagcggcggcacctcgggtggcagcagcggcaccacgggcggcacgacg
ggcgccaacacgggttccaccgcgggtggcacgtcgagcggcggcacaacggctgcgggc
gggtcgggtgcaggatcgcatgacgccgcgcaggttggagttatcggtctcttcgacctc
ggcgactcgctgcacaacgcgagcctctacggccaggcgatgcagtcggtcgtgcaaggc
ttcctgcaaggcggcatgcattgcgatacgttcgacttgcgcggcatctgcgtgtcgacg
ggtgccctttacagccacaacgctggcgaggtgagcggttcgaactggcagggcgacttc
agcatcgcatatcgcttcagcccgaactgggtcgctggcttcggctatcaggggccgtcc
tacaagcttgaggtcggtaacgatacggtccgcagccgcgccgatacttttggcgcattc
gtcgagtacggcaaccgtctgcgccagggcgctttcgcccgcgccgcgattgcgtatcaa
cagggggacgcgacggtcaaccgttcatatttgaccggttcgggtctcgataactcgcag
ggcgaaacggcgatcgggcaacgcgccgtgtcgacgcaagcgggctacgtttttgtcgtg
aaaaacatggccgtgatgccatacgtgggcgtcgattatcttcgcaccacgatcgatggc
tataccgaaaccacgggccagtttccggttcgcttcaacggccgcgacgaagacaacgtg
tatggcaccgtcggtgtgaacggacatctgaacatcgctggcaaggctatcgtctcggcg
ggcctgaagcatgtccagcgcctgaacaagaacaacgatccggtatcgggcgacgttctc
ggcctcggttcgttctcgatcaatcaggacacgacggagcactggaacgaagtcgccgtc
ggcgtgcaattcgccggccccgccaaggcttcgcgcgtgaacatcggctacggccatcgt
ttcgcaagcggcaccagcgtcgcgcgtgacatcgcctcggtgtcgttcacgatgggattc
tga

DBGET integrated database retrieval system