KEGG   Burkholderia vietnamiensis: Bcep1808_7029Help
Entry
Bcep1808_7029     CDS       T00493                                 

Definition
protein-disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
bvi  Burkholderia vietnamiensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pBVIE01:397035..397751
Genome map
AA seq 238 aa AA seqDB search
MKKFAAALLLAGLSVAAFASPETDSVLATLKSKYPNTNFTSIEASPLPGIYELTMGKNIA
YTDKEGHYFLFGSLYDMEKRQDLTAPKREAASKIDVSKLPLKDAIVRVKGKGTRKLYLFT
DPDCPFCKELERDTLPKLDDVTIYTFMFPLDSLHPQARAKSESIWCLPEKERGAAWDKLL
TTGTPPAMAKCDNPLAALSSLGDSLGVRGTPTMFSEDGRILPGAAAPERIDAFLNAGK
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagtttgctgctgcactcctgctggctggcctgtcggtcgctgcattcgcgtcg
cccgaaacggacagcgttctcgcgacgctcaagtcgaagtatccgaatacaaacttcacc
tcgatcgaggcctcgccgctgccgggcatctacgagctgacgatgggcaaaaacattgcc
tacacggacaaggaaggtcattacttcctgttcggtagcctgtacgacatggaaaagcgt
caggatctgacggcgccgaagcgcgaagcggctagcaagatcgacgtgagcaagctgccg
ctgaaagacgccatcgtgcgggtgaaaggcaaaggcacgcgcaagctgtacctcttcacg
gaccccgactgcccgttctgcaaggaactcgagcgcgataccctgccgaagcttgacgac
gtgacgatctacacgttcatgttccccctcgattcgctgcatccgcaggcacgcgcgaaa
tcggaatcgatctggtgcctgcccgagaaagagcgcggtgccgcctgggacaagctgctg
accaccggcacgccgccggcaatggcgaagtgcgacaacccgctggcggcgctgtcgtcg
ctgggcgacagcctcggtgtccgtggcacgccgacgatgttcagcgaagacgggcgcatc
ttgccgggcgcggcagcgccggagcgtatcgacgcattcctgaacgcaggcaagtaa

DBGET integrated database retrieval system