KEGG   Burkholderia vietnamiensis G4: Bcep1808_7282Help
Entry
Bcep1808_7282     CDS       T00493                                 

Definition
(GenBank) protein of unknown function DUF477
  KO
K06872  
uncharacterized protein
Organism
bvi  Burkholderia vietnamiensis G4
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
pBVIE02:complement(245421..246215)
Genome map
AA seq 264 aa AA seqDB search
MADVAVPPLTARVTDQTGTLTSDQVSRLEQTLQAFESRKGTQIAVLIVPTTEPETIEQYS
LRVVEQWKLGRKKVDDGALLIVAKNDRTLRIEVGYGLEGALNDAISNRIINEIIVPRFRE
GDFSGGITAGIDQMIRVADGESLPPPQSRKGEGPPNVWRFAPVIFMLAVVFGSTLRAMFG
RLPGAAVAGGVVAVIAWLLAAGLAATVVAGVIAFLFTLTSGGMGGYVGTYGLGRRGGGFG
RGGRGGGFGGGGGGFGGGGASGRW
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgtcgccgtgccgcctctgacggcccgcgtcacggaccaaacgggcacgctc
accagcgatcaggtgagcaggctcgaacagacgctacaggcgttcgagagcagaaagggc
acgcagatcgcggttctgatcgttcccaccaccgagccggagacaatcgagcaatactcg
ctgcgcgtggttgaacaatggaagctcgggcgcaagaaagtggatgatggggcgttgctc
atcgtcgcaaaaaatgaccgcacgctgcgcatcgaggtcggttacggcctggagggcgcg
ctcaacgatgcgatcagcaaccggatcatcaacgagatcatcgtgccgcgattccgggaa
ggcgacttctccggtggcattacggcaggaatcgatcagatgatccgggtggccgacggt
gagtcgttgccgcccccgcagtctcgcaaaggggaaggtccccccaacgtctggcggttt
gcgcccgtcattttcatgctggcggtcgtgtttggcagtaccctgcgcgccatgttcggc
agattgcccggagccgccgtggccggcggcgtcgtggctgtaattgcctggttgctggcg
gcaggtctcgccgcaacggttgtggcaggtgtgatcgccttcctgttcacactgaccagc
ggagggatggggggctacgttggaacctacggtctcgggcgtcgtggcggcggatttgga
cgcggcgggcggggtggcgggttcggcggtggcggtggtggctttggtggcggtggcgcg
tcaggcaggtggtga

DBGET integrated database retrieval system