KEGG   Burkholderia vietnamiensis G4: Bcep1808_7604Help
Entry
Bcep1808_7604     CDS       T00493                                 

Definition
(GenBank) Semialdehyde dehydrogenase, NAD - binding
  KO
K18366  acetaldehyde/propanal dehydrogenase [EC:1.2.1.10 1.2.1.87]
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
bvi00362  Benzoate degradation
bvi00620  Pyruvate metabolism
bvi00621  Dioxin degradation
bvi00622  Xylene degradation
bvi00650  Butanoate metabolism
bvi01100  Metabolic pathways
bvi01120  Microbial metabolism in diverse environments
bvi01220  Degradation of aromatic compounds
Module
bvi_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:bvi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bcep1808_7604
   00650 Butanoate metabolism
    Bcep1808_7604
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bcep1808_7604
   00622 Xylene degradation
    Bcep1808_7604
   00621 Dioxin degradation
    Bcep1808_7604
Enzymes [BR:bvi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Bcep1808_7604
    1.2.1.87  propanal dehydrogenase (CoA-propanoylating)
     Bcep1808_7604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA DUF2642
Motif
Other DBs
NCBI-ProteinID: ABO60477
JGI: Bcen18087604
UniProt: A4JW24
Position
pBVIE04:51326..52237
Genome map
AA seq 303 aa AA seqDB search
MKKIKCALIGPGNIGTDLLAKLKRSSVLEPVWMVGIDPESEGLKRARELGVKTTAEGVDG
LLPHVLADGVQIAFDATSAYVHAENARKLNALGVMMIDLTPAAIGPYCVPPVNLKEHLGK
REMNVNMVTCGGQATIPMVAAVSRVQPVAYAEIVATVSSRSVGPGTRKNIDEFTRTTAGA
VEKVGGARKGKAIIIINPAEPPLMMRDTIHCLTETEPDQQRITESIHAMIEEVQKYVPGY
RLVNGPVFDGKRVTVFMEVAGLGDYLPTYAGNLDIMTAAAARTAEMFAEEMIAGNLTLEP
VVA
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatcaaatgtgcgctgatcggaccaggcaatatcggcaccgatctgctggcc
aagctcaagcgcagctcggtgctggagccggtgtggatggtgggcatcgacccggaatcg
gaggggctgaaacgagcccgtgagctcggcgtcaaaaccacggcggaaggtgtcgacggg
ctgctgccgcatgtgctggccgatggtgtgcagatcgcgtttgatgccaccagtgcatat
gttcacgcggaaaacgcgcgcaagctcaacgcgctgggcgtgatgatgatcgatctgacg
ccggcggcaattggcccgtactgcgttccgccggtcaatttgaaagagcacctgggcaaa
cgcgagatgaacgtaaacatggtcacctgtggcgggcaggccaccattccgatggtcgct
gcggtctcgcgcgtgcagccggtggcatacgcggaaatcgtcgcgaccgtatcgagccga
tcggtggggcccggcacgcgcaaaaacattgacgaattcacgcggaccacggccggcgcg
gtggaaaaggtggggggcgcgagaaagggcaaagccatcatcatcatcaacccggcggag
cctccgctgatgatgcgcgacacgattcattgcctgaccgaaaccgagccggatcagcaa
aggattaccgagtccatccacgccatgatcgaagaggtccagaagtacgtgcccggttac
cggctggtcaacggcccggtgtttgacggcaagcgtgtgacggtcttcatggaggtggcg
ggcctgggggactatctgcccacgtacgccggcaacctggacatcatgaccgctgccgcg
gcccggaccgccgagatgtttgccgaagagatgattgccggcaatctcacgctcgaaccg
gttgtcgcttga

DBGET integrated database retrieval system