KEGG   Burkholderia vietnamiensis: Bcep1808_7604Help
Entry
Bcep1808_7604     CDS       T00493                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
bvi  Burkholderia vietnamiensis
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bvi00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bvi00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:bvi00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:bvi00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:bvi00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pBVIE04:51326..52237
Genome map
AA seq 303 aa AA seqDB search
MKKIKCALIGPGNIGTDLLAKLKRSSVLEPVWMVGIDPESEGLKRARELGVKTTAEGVDG
LLPHVLADGVQIAFDATSAYVHAENARKLNALGVMMIDLTPAAIGPYCVPPVNLKEHLGK
REMNVNMVTCGGQATIPMVAAVSRVQPVAYAEIVATVSSRSVGPGTRKNIDEFTRTTAGA
VEKVGGARKGKAIIIINPAEPPLMMRDTIHCLTETEPDQQRITESIHAMIEEVQKYVPGY
RLVNGPVFDGKRVTVFMEVAGLGDYLPTYAGNLDIMTAAAARTAEMFAEEMIAGNLTLEP
VVA
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatcaaatgtgcgctgatcggaccaggcaatatcggcaccgatctgctggcc
aagctcaagcgcagctcggtgctggagccggtgtggatggtgggcatcgacccggaatcg
gaggggctgaaacgagcccgtgagctcggcgtcaaaaccacggcggaaggtgtcgacggg
ctgctgccgcatgtgctggccgatggtgtgcagatcgcgtttgatgccaccagtgcatat
gttcacgcggaaaacgcgcgcaagctcaacgcgctgggcgtgatgatgatcgatctgacg
ccggcggcaattggcccgtactgcgttccgccggtcaatttgaaagagcacctgggcaaa
cgcgagatgaacgtaaacatggtcacctgtggcgggcaggccaccattccgatggtcgct
gcggtctcgcgcgtgcagccggtggcatacgcggaaatcgtcgcgaccgtatcgagccga
tcggtggggcccggcacgcgcaaaaacattgacgaattcacgcggaccacggccggcgcg
gtggaaaaggtggggggcgcgagaaagggcaaagccatcatcatcatcaacccggcggag
cctccgctgatgatgcgcgacacgattcattgcctgaccgaaaccgagccggatcagcaa
aggattaccgagtccatccacgccatgatcgaagaggtccagaagtacgtgcccggttac
cggctggtcaacggcccggtgtttgacggcaagcgtgtgacggtcttcatggaggtggcg
ggcctgggggactatctgcccacgtacgccggcaacctggacatcatgaccgctgccgcg
gcccggaccgccgagatgtttgccgaagagatgattgccggcaatctcacgctcgaaccg
gttgtcgcttga

DBGET integrated database retrieval system