KEGG   Barnesiella viscericola: BARVI_04125Help
Entry
BARVI_04125       CDS       T02986                                 

Definition
sialidase
Orthology
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
bvs  Barnesiella viscericola
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bvs00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    BARVI_04125
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BARVI_04125
Enzymes [BR:bvs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     BARVI_04125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(1001627..1003258)
Genome map
AA seq 543 aa AA seqDB search
MRRFFLFLSWVGLAAIAVAADTVFVKEARVPVLLERQDNVLFYLRIPARESRVLDGVTLD
LSDCDARGDIAAVKLYYGGVEARQDEGKNRFAPVAYVSSQHAGKTLAADPSYSIECARVD
NPGKRIELRADYKLYPGVNFFWVSVQMKPGASLASKLRAGVESVSLDGAAALCRRVSPEG
IEHRMAIGVRHAGDDGVAAFRIPGLVTTDRGTLLGVYDVRYNSSVDLQEHIDVGLSRSTD
GGKSWEPMRLPLSFGEYGGLPAAQNGVGDPSILFDPHTRTVWIAAAWTHGMGNQRAWWSS
QPGMDMERTAQLVLTKSTDDGQTWSAPINITSQVKDPSWRFLLQGPGRGIAMHDGTLVFP
IQFIDSVGVPSAGVMYSRDGGESWHIHNPARSNTTEAQVVELADGVLMLNMRDNRGGSRA
VAVTADLGRTWTEHESSRRALPEPVCMASLIRVEADDNVLGRDLLLFSNPNTTKGRHHIT
VKASLDGGATWLPENQLLLDEEEGWGYTCLTMVDRETVGILYESSVAHMTFQTFKLTELV
RKK
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgcgaagatttttcctctttctctcttgggtggggctggccgcgatagcggtggccgcc
gatacggtttttgtcaaggaggctcgggtgccggtactgctcgagcggcaggacaatgtg
ttgttctatttgcgtattcccgcccgggagagccgggtgctcgacggggtgacgctcgat
ttgtcggactgtgatgcccggggtgacatcgctgccgtaaaactctattacggtggtgtg
gaggctcggcaggacgaggggaagaatcgctttgccccggtcgcctatgtgtcgagccag
catgccggtaagacgttggcggccgacccgtcgtattcgattgaatgcgcccgggttgac
aatccgggcaagcggattgagttgcgggccgactacaagctgtacccgggtgtcaatttc
ttttgggtgagtgtgcagatgaagccgggcgcctcgctcgcctcgaagctgcgggccggg
gtggagtctgtctcgctcgacggggcggcagctctctgccggcgagtgtcgcccgagggt
atcgagcaccgcatggccatcggggtgcgccatgccggcgacgacggggtggcggcgttc
cgcattcccgggttggtgacgaccgaccggggtacgttgctgggagtgtatgacgtgcgc
tacaacagcagtgtcgacttgcaggagcacatcgacgtggggctgagccgcagcaccgac
ggcggcaagagttgggaacccatgcgtttgcccctctcgtttggcgaatatggcggtctg
cccgccgctcagaatggcgtgggcgacccctcgatactcttcgacccccacacccgcacc
gtgtggattgccgcggcctggactcatggcatgggcaaccagcgggcctggtggagttcg
caaccgggcatggatatggaacgcacggctcagctcgtgctcaccaaaagtaccgacgac
ggccaaacctggtcggcccccatcaacatcacttcgcaggtgaaagacccctcgtggcgg
ttcctgctgcaaggtccggggcggggtatcgccatgcacgacggtacgctggtctttccc
attcagtttatcgactcggtgggggtacccagtgccggggtgatgtacagccgcgacgga
ggcgagagttggcacattcacaatccagcccgaagcaataccaccgaggctcaggtggtc
gagttggccgacggtgtactcatgctcaacatgcgcgacaaccggggcggaagccgggcg
gtggccgtcaccgccgatctgggccgtacctggaccgaacacgagtcgtcgcgccgggct
ctgcccgagccggtgtgtatggccagcctcattcgggtcgaggccgacgacaatgtgctg
gggcgcgacctgctgcttttctccaaccccaacaccaccaaggggcgccatcacattacg
gtcaaggccagtctcgacggtggggccacctggctccccgagaatcaattgttgctcgac
gaggaggaggggtgggggtacacctgccttacgatggtcgaccgcgaaacggtgggcatt
ctctacgagagcagtgtggcgcacatgacttttcaaacgtttaaactcaccgaactcgtc
cgtaaaaaatag

DBGET integrated database retrieval system