KEGG   Barnesiella viscericola: BARVI_09125Help
Entry
BARVI_09125       CDS       T02986                                 

Definition
3-oxo-5-alpha-steroid 4-dehydrogenase
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
bvs  Barnesiella viscericola
Brite
Enzymes [BR:bvs01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     BARVI_09125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(2165085..2165858)
Genome map
AA seq 257 aa AA seqDB search
METATFNIFLIVMAVTALIVFIALHFVSAGYGMLFDRKWGVSLPNRIGWVVMEAPVFIAM
LVLWLLSPDEYRYDPVRIAFLVLFEVHYFQRSFIFPFLIKGNSRMPLSIVSMGVVFNLLN
AFMQGGWIFYISPLDYYTPAWFTSPQFIIGVIAFVAGMYINIQSDSIIRHLRKPGDRRHY
IPRGGMFRWVSSANYFGEFLEWVGFAIFTWSWSGAVFAWWTFANLAPRSASLYKRYTQEF
GEEFTREKRKKIIPFIY
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccgccacattcaatattttcttaatcgtaatggccgtcacggccttgatcgtg
tttattgccctccatttcgtgagtgcgggttacggcatgcttttcgaccgcaagtgggga
gtctcgctgcccaaccgcatcgggtgggtggtgatggaggccccggtattcattgccatg
ctcgtgctgtggctgctctcccccgacgaatatcgctacgacccggtgcgcatcgccttt
ctggtgctgttcgaggtgcactacttccaacgctcgttcatcttccccttcctcatcaag
gggaacagccgcatgcccctcagcatcgtgagcatgggtgtcgtgttcaacctgcttaac
gccttcatgcagggagggtggattttctacatttcgccgctcgactactataccccggcc
tggttcacctcgccccagttcatcatcggggtgattgccttcgtggccggcatgtacatc
aatatccagtccgactccatcatacgtcacctacgcaagccgggcgaccggcgtcactat
atcccgcggggcggcatgttccgctgggtttcgtcggccaactacttcggcgaatttctc
gaatgggtaggattcgccatcttcacctggtcgtggtcgggtgccgtctttgcctggtgg
acatttgccaacctggctccccgctcggcctcactctacaagcgctacacccaggagttc
ggcgaggagttcacacgagagaaacgcaaaaagataattcctttcatctattga

DBGET integrated database retrieval system