KEGG   Barnesiella viscericola: BARVI_10655Help
Entry
BARVI_10655       CDS       T02986                                 

Definition
(GenBank) glucosylceramidase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
bvs  Barnesiella viscericola
Pathway
bvs00511  Other glycan degradation
bvs00600  Sphingolipid metabolism
bvs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bvs00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    BARVI_10655
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BARVI_10655
Enzymes [BR:bvs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     BARVI_10655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Glyco_hydro_59 Glyco_hydr_30_2
Motif
Other DBs
NCBI-ProteinID: AHF13130
UniProt: W0EQQ1
Position
2505633..2507111
Genome map
AA seq 492 aa AA seqDB search
MKRMTLHSILTHLCLIMCTAGAVCQNHYLPNPTLLIEHDTTPADIKACYVSYDGSKLLST
ENLKFDDSSRDKSEGMININTNQLYQEIDGFGFAITGSASYNLSKMEAYRRHDFLVRTFS
PDENVGYGCSYLRVPIGCSDFSLSDYTCCDTPGIENFALTNEETRYIIPVLQEILQINPD
IKIIGAPWTAPRWMKTNGEWTAGHLREECYQDYALYFVKWIKAFAENGIHITAVTPQNEP
LHGGNSASMFMLWEEQRDFIKTALGPSFRDNNIDTKIYVFDHNYSYDNWEGQIGYPSLIY
SDSQAKQYISGAAYHNYSGDASEMTAIHDANPDMALLFTEWTAGEWYLRVDHARILEDVK
NLIFDVVNNWGRGAIVWNMILDNNHGPYRPGGCFNGNGAVDIDIETYGKITYNSFYYTIC
LAMTASRPGGHRASVDGNVADTEFVAFSNPDGTTGIIATNNSVNAKKVTIYDGKRYFCID
IPPLTAASYRWQ
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaatgacattacacagtattcttacgcacctctgtctgataatgtgtaccgcc
ggtgcggtgtgtcagaatcattatcttcccaatccaactctgcttatagaacacgataca
acgccggcagatataaaagcctgttatgtatcatatgatggatcgaagctgctgtcgacc
gaaaacttgaaatttgacgacagcagccgggacaagtcagagggtatgataaacataaac
accaatcaattatatcaggaaatcgacggttttggctttgccatcaccggctcggcatca
tacaatctatccaagatggaagcatatcgacgccacgattttcttgtccgtacattctcg
cccgatgagaatgtcggttatggatgctcttatttaagggtgcccataggttgcagcgac
ttttcgttgagcgactatacatgctgtgatacacccggtatcgagaattttgcactcact
aacgaagaaactcgttatattattcctgtgttgcaggaaatattgcagattaatcccgat
atcaaaattatcggcgccccgtggactgccccccgctggatgaaaactaacggagaatgg
acagcaggtcatctacgtgaagaatgttatcaggattatgccttgtatttcgtgaaatgg
ataaaggcttttgctgaaaatggcatccacattactgctgtcacccctcagaacgaacct
ctccatggaggtaatagcgcttcgatgtttatgctttgggaagagcaacgcgatttcatc
aagacagcccttggtccgtcgttcagagacaataatatcgacactaaaatttatgtgttt
gaccataattatagctacgataattgggagggacagataggttatcccagtctgatatat
tccgattctcaagccaaacaatatatttctggagccgcatatcataattatagcggggat
gcttcggaaatgaccgcaatacacgacgccaatcctgatatggcattgctttttacggaa
tggacggcaggagaatggtacctgcgagtggatcatgcaagaattctcgaagatgtgaaa
aatctgatttttgatgttgtcaacaactgggggcgcggtgcgatagtgtggaatatgata
cttgataacaatcatggaccgtatcgtccgggaggatgctttaacggtaacggagctgtt
gacattgatatcgagacatatggcaagataacatataattcattttactatacaatttgc
ctggcgatgacagcctcacgacccggtggacacagagcgtctgttgacgggaatgtcgcc
gacacggagttcgtagccttttcaaatccagacggtacaacaggaatcatagctaccaac
aattctgtcaatgcgaagaaagtgacgatttatgatggcaagagatacttttgcattgat
atcccacctctcactgcggcatcctatcgttggcaatga

DBGET integrated database retrieval system