KEGG   Bacteroides vulgatus: BVU_0041Help
Entry
BVU_0041          CDS       T00546                                 

Definition
beta-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
bvu  Bacteroides vulgatus
Brite
Enzymes [BR:bvu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     BVU_0041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(60312..61433)
Genome map
AA seq 373 aa AA seqDB search
MKIRYVTLLAAIAGLMAACGNDRKVEPGPSLKEAASGKFLMGVALNVRQAAGQDTYASKV
VKRHFNSIVAENCMKCEVIHPEEDRFDFTEADRLVRFGEENDMAVIGHCLIWHSQLAPWF
CVDEQGKTVSADILKERIKKHIQTIVTHYKGRIKGWDVLNEAIESDGSWRKSPFYEILGE
EYIPLIFQYAHEADPEAELYYNDYGMDGKAKRDKVVELVKMLKDRGLRIDAVGMQGHMGM
DYPSVSEFEASILAFAATGVKVMVTEWDMSALPTARMGANISDTVSYKQSLNPYPDGLPD
SVSVAWNNRMKEFFGLFLKHSDIITRVTVWGVTDGDSWKNNFPVPGRVDYPLLFDRDCQP
KPFVEELIGKHNI
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataagatatgtgacattattggctgccattgccggattaatggccgcttgcggc
aatgaccggaaggtcgagccgggtccttcgctgaaggaagcagcttcgggcaagtttctg
atgggggtagcgttgaatgtacgtcaggcagcaggtcaggatacttacgcctcgaaagtg
gtaaaacgtcattttaattccattgtggccgagaattgcatgaaatgcgaagtgattcat
ccggaggaagaccgttttgattttacggaagcggaccggttggttcgttttggcgaggag
aacgatatggctgttatcgggcattgccttatctggcattcacagctggcaccttggttc
tgtgtggacgaacaaggaaaaacagtaagtgccgacatcttgaaggagcgtataaaaaaa
catatccagactattgtgacgcactataaagggcgtataaagggctgggatgtattgaat
gaagccattgaatcggacggctcctggcgtaaatctcctttttacgagatattaggcgaa
gagtacatcccgcttatttttcagtatgctcatgaagcggatccggaagccgaactttac
tataatgattatggcatggacgggaaggctaagcgtgacaaagtagtcgaattggtaaag
atgctgaaagaccgtggactgcgcatcgacgcggtaggtatgcagggacacatgggaatg
gattatccgtcagtgtccgaatttgaagccagtatactggcatttgcagctaccggagta
aaggtgatggtaaccgaatgggatatgagtgcattgcccacggcacggatgggagccaat
atttcggatacggtgtcttataaacaatccttgaatccctatcccgacggtttgcccgac
tctgtgtctgtggcatggaataaccggatgaaggaatttttcggtcttttcctgaaacat
tcggatatcattacccgtgtgacagtgtggggggtgacggacggtgactcatggaagaat
aatttccctgtgcccggacgtgtggattaccctttattgttcgaccgtgattgccagccg
aaaccttttgtggaagaactgataggaaaacataacatttaa

DBGET integrated database retrieval system