KEGG   Bacteroides vulgatus: BVU_0085Help
Entry
BVU_0085          CDS       T00546                                 

Definition
(GenBank) glycoside hydrolase family 20, candidate beta-N-acetylhexosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
bvu  Bacteroides vulgatus
Pathway
bvu00511  Other glycan degradation
bvu00520  Amino sugar and nucleotide sugar metabolism
bvu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bvu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BVU_0085
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BVU_0085
Enzymes [BR:bvu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BVU_0085
Chaperones and folding catalysts [BR:bvu03110]
 Intramolecular chaperones
  Others
   BVU_0085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b PA14 Fn3_assoc CHB_HEX_C_1 CHB_HEX_C GLEYA Sipho_tail Glycohydro_20b2 DUF4399
Motif
Other DBs
NCBI-ProteinID: ABR37815
UniProt: A6KWK1
Position
122740..125046
Genome map
AA seq 768 aa AA seqDB search
MTKCTHKQLMTACMLAGTLMLGACTSTPPVTKEVSIVPITNHLEETNGAFVLKSNTSIGV
IDAELIPAAEYLADMLSGATGYDLKVKEGEGTITLALGDVQGKEGAYTLTAESDKVNITG
NSYGGVIAGIESLRQLFPPQIESKEIVKGTDWAIPAVNIQDAPRFEWRGIMLDVSRHFYT
IDEVKELLDVMALYKMNKFHWHLTDDQGWRIEIKKYPLLTEKGAWRKFNSHDRECIRQSK
TDNNPDMAIPEDKIRIVEGDTLYGGYYTQEDIKDVIAYAKIRGIDIIPEIDMPGHMLAAV
SNYEGVSCFNETGWGSVFSSPVCPGKDSALEFCKNVYAELIALFPYKYVHIGGDEVEKTN
WKKCPDCQKRMHDNNLKTEEELQSWFIHDMERFFNGKGKEMIGWDEIIEGGLSKTATVMW
WRSWVKDAATKATAQGNPVIFTPNGQFYLDYAEDKNSMASIYNLDTTDNLTPEQQSLILG
VQGNIWCEWIPSNARMQYMTIPRLLAIAELGWSKPEQKDWNAFKQRLSDQFERLNIMGIN
YRIPDLEGFNAVNAFIGEGTINVTCLDPTAEIHYTTDGSTPTLQSPVYEGPIKVTETTDF
TFCTFRPNGKKGDIAKTRFIKSEYTPSVTAAPSNPGLKATWHEFKGNKCSEIEKAPINGT
YPVEDVMIPKKVKGNIGLIIKGYFNAPQDDIYTFALLSDDGSTLTIDSEQIVDNDGPHGP
KEIVGQKALAKGYHPMELRYFDQNGGQLKLKVTGSDGKEIPFTHLYAH
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaatgtacacataagcagttaatgaccgcctgtatgttagcaggcacattgatg
ttgggagcatgtaccagtactccccctgtaacaaaagaggtatccattgtacccataacc
aaccatctggaggaaacaaacggtgcttttgtattgaaaagtaatacctccatcggtgtt
attgacgccgaactaattcccgcagccgagtatttggccgatatgctttccggtgccaca
ggctacgaccttaaagtaaaagaaggcgaaggaaccatcacccttgccttgggggatgtt
caaggaaaagaaggtgcctataccctgacagccgagagcgataaggtcaacattacaggt
aactcttacggaggtgtcattgcaggtatcgaatccctcagacagctgtttcccccgcaa
atagaatctaaagaaattgttaaaggtacagactgggccataccggccgttaacattcaa
gatgccccccgctttgaatggagaggcatcatgctggacgtatcccgccatttctacaca
atagatgaggtgaaagaattactggatgtcatggccctttacaagatgaataaattccac
tggcatcttaccgatgaccaaggatggcgtatcgaaatcaagaaatatcctttactgacg
gaaaaaggagcctggcgcaaattcaattcccatgaccgcgaatgcatacgtcagtcaaag
actgataacaatccggatatggcaattcccgaagacaagatacgcatcgtagaaggtgac
accctatatggaggctactacactcaggaagatatcaaggatgtcatagcatacgccaaa
atacgaggcatagatattattcccgaaattgatatgccgggacacatgctggcagctgtg
agtaactatgaaggtgtttcctgttttaacgaaaccggttggggaagcgtcttctcctca
cctgtttgtccggggaaagactctgcattggagttctgcaagaatgtttatgcagaactg
atagcccttttcccctataagtatgtacatataggaggtgacgaagtagaaaaaaccaat
tggaaaaaatgtccggactgccagaaacgtatgcatgacaataatctgaaaaccgaagaa
gaactgcaatcatggttcattcatgacatggagagattctttaacgggaaaggcaaagaa
atgataggctgggatgaaatcattgaaggcggattgtctaaaacagccaccgtaatgtgg
tggcgcagctgggtaaaagatgcagcgaccaaggcaacggcacaaggcaaccctgtcatt
ttcactcctaacggacaattttatttggattatgcagaagacaagaattctatggcaagc
atttataatctggatacgacagacaacctgactcccgagcagcagtcgctgattttagga
gtgcagggaaatatttggtgcgaatggattccttccaacgcacgtatgcaatatatgacc
attccacgtttgctggctattgccgaattaggttggagcaaaccggagcaaaaagactgg
aatgccttcaaacaacgcctgtctgatcagtttgaacgtctcaatatcatgggtatcaat
taccgtatacccgatttggaaggctttaatgccgtcaacgcctttatcggtgaaggaacc
atcaatgtaacttgccttgaccccactgcggaaattcactataccactgatggcagtact
cctactttacaatctcccgtatatgaaggtcccatcaaagtgactgaaaccacagacttt
actttctgcaccttccgccctaatggaaagaaaggtgacatagccaagacacgtttcatc
aaaagtgaatataccccctctgtaactgccgctccttccaatccgggtttgaaagctaca
tggcacgaatttaaaggaaataaatgcagtgaaatagaaaaagctccgatcaatggtact
tatccagtggaagacgttatgattcctaaaaaagtaaaaggaaatatcggactgattatc
aaaggatatttcaatgctcctcaagacgatatctacacttttgcactcctgtccgacgat
ggtagtacattgaccatagacagtgaacagatagtagacaatgacggacctcacggacct
aaagaaatagtgggacaaaaggcattggcgaaaggatatcatccaatggaattacgttat
ttcgaccaaaacggaggacaactgaaattaaaagtaacaggtagtgatggtaaagaaatt
ccgttcacgcatctctatgcgcattaa

DBGET integrated database retrieval system