KEGG   Bacteroides vulgatus: BVU_0191Help
Entry
BVU_0191          CDS       T00546                                 

Definition
ROK family transcriptional repressor
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bvu  Bacteroides vulgatus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bvu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BVU_0191
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BVU_0191
   00052 Galactose metabolism
    BVU_0191
   00500 Starch and sucrose metabolism
    BVU_0191
   00520 Amino sugar and nucleotide sugar metabolism
    BVU_0191
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BVU_0191
   00524 Butirosin and neomycin biosynthesis
    BVU_0191
Enzymes [BR:bvu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BVU_0191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(299939..300910)
Genome map
AA seq 323 aa AA seqDB search
MVTGMEKPYVVGMDIGGTNTVFGIVDSRGNVLATDSVKTQSFSKIEDYVEAVSSKLRPLI
ESFGGVEKIKGMGVGAPNGNYYNGTIEFAPNLPWKGVIPLATLFEEAIGVPTALTNDANA
AAIGEMTYGAARGMKDFIMITLGTGVGSGIVINGQLVYGHDGFAGELGHVIVRRDGRQCG
CGRKGCLETYCSATGVARTAREFLVARPEPSLLRDIPAEDIVSKDVFDAAVRGDKLAQDI
FEYTGRILGEALADFIAFSSPEAIILFGGLAKSGDYIMKPIRKAIDDNILKIYEGKTKLL
ISELKDADAAVLGASALGWEVRE
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggtaacaggcatggaaaaaccctacgtagtaggtatggacattggcggaactaataca
gtttttggcatcgtagattcgcgtggtaacgtattggctaccgattcagttaagacacaa
tcattttctaagatagaggattatgtagaggctgtcagttcaaaattgcgtccgttgatt
gaatcgttcggtggcgtagaaaaaattaaaggtatgggtgtaggtgctcctaatggaaac
tactataacggaaccattgaatttgctccgaatcttccttggaaaggggtgattcccttg
gctactttgtttgaagaagcaataggtgttcctactgccttgacaaatgatgctaatgct
gccgctatcggtgaaatgacttatggtgcggctcgtggcatgaaagactttattatgatt
actcttggaaccggtgttggtagtggtatcgtaataaatggacaactggtttacggacac
gatggttttgccggagaattgggacatgtgatagttcgtcgtgacggacgtcagtgtggt
tgtggtcgtaagggctgtttggaaacttattgttcggctacaggtgtggcacgcacggca
cgtgaatttctggttgcccgtcccgaacctagtttgttaagagatatcccggctgaagat
attgtatctaaagatgtttttgacgcggctgtaagaggggataaattagcacaagatatc
tttgaatatacaggacgtattttgggtgaggctttggcggatttcattgctttctccagc
ccggaagcgattatcctgtttggtggattggcaaaatcaggtgattatatcatgaagccg
atccgtaaagctatagatgataatatcttgaagatttacgaaggtaagactaaattgttg
atttctgaattgaaggatgctgatgccgccgtgttgggagctagtgcattaggctgggaa
gtaagagaataa

DBGET integrated database retrieval system