KEGG   Bacteroides vulgatus: BVU_0357Help
Entry
BVU_0357          CDS       T00546                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bvu  Bacteroides vulgatus
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bvu00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    BVU_0357
Enzymes [BR:bvu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     BVU_0357
Exosome [BR:bvu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BVU_0357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(515983..517479)
Genome map
AA seq 498 aa AA seqDB search
MISRIITIDQSTSATKAMLFSEDCELLHRVNIEHQQFYPQIGWVEHDAEEIYKNTIEAIH
CLLEQEEVNGKDISYSLAITNQRETVVVWNRHTGKSVYHAVVWQCQRGAAICKELKDKGY
SELVQRKTGLLIDPYFSASGAKWILDNVENARELAEKGDLLMGTIDSWLIWKLTEGRKHL
TDYTNASRTMLFNIHTLDWDEELLKLFTIPRNMMPEALPCDAVFGETTIEGLFKSPIQIA
GVLGDSHGALTGQMCFEAGMGKVTYGTGSSVMVNIGEEAVAAPEGLVTSVGFSALGKVYY
AFEGNIHCTGATIKWMVEKLGLVDSFNQIETLATSVKNNDGVYLVPAFTGLGAPWWKPDA
KAAIWGMTLNAGKAHVLRAGLESIAYQVKDLIDMMTRQAGIELKALRVDGGPTKNQFLMQ
FQADMLHAVINRSEIEEASALGAVVMNGFARKKWASFQEAAAMRTIDNCIAPCMEEKELQ
SLYSGWREAVKKVIGQNN
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgattagcagaataattaccatagatcaaagtacttcggcaacaaaagccatgctgttc
tctgaagattgcgaattgttgcatcgggtaaatatagaacatcagcaattctacccgcag
ataggatgggtagagcatgatgccgaagaaatctataaaaataccatagaagcgatacat
tgtctgcttgaacaagaagaagtgaatggaaaggatatttcttattctcttgccatcacc
aatcagcgcgaaacggtggttgtttggaaccgacataccggcaagtccgtttatcatgcc
gtggtatggcaatgccagcggggagcggctatttgcaaagaactgaaagataagggatac
agcgaactggtacaacgaaagaccggattgcttatcgatccttatttttctgccagtggt
gctaagtggatattggataacgtggaaaatgcacgtgaactggcagaaaaaggcgatttg
ttgatgggaactattgattcctggctgatttggaaattgaccgaaggcaggaagcatctg
actgattatacgaatgcgtcgcgtaccatgctttttaatattcatactttggactgggat
gaagagttgttgaaactcttcactattccccggaatatgatgccggaagcgttgccctgt
gatgctgtttttggagaaacaacgatagagggtttgttcaaatctccgatacaaatagca
ggtgttttaggtgattcccatggagcattaaccggtcagatgtgttttgaggcaggtatg
ggcaaggtgacttatggaacgggatcatctgttatggttaacattggagaagaggctgtc
gctgctcctgaagggctggttacatccgtcggattctcggctttgggtaaagtgtattat
gcttttgagggcaatatccattgcaccggagccactatcaaatggatggtggagaaattg
ggattggtggactcgttcaatcaaattgaaaccttggcgacttcggtgaaaaataatgat
ggagtctatctggttcccgcctttaccggattgggagctccctggtggaaaccggatgct
aaagctgccatctggggaatgacactgaatgctggaaaagcgcatgtgctgcgtgcagga
ttggaatccattgcttatcaagtgaaggatttgatagacatgatgacccggcaggcagga
atcgagctgaaagcgttgcgtgttgacggaggccccacgaagaatcagttcctgatgcag
tttcaggctgatatgctgcatgccgtcattaaccgttcggagatagaggaagcttctgca
ttgggggctgttgtcatgaatggctttgcccgtaagaagtgggccagtttccaagaagcc
gctgccatgcgtaccattgacaattgcatcgctccctgtatggaggaaaaagaacttcaa
tctttgtatagtggctggcgtgaggctgttaagaaagtaataggacagaataactaa

DBGET integrated database retrieval system