KEGG   Bacteroides vulgatus: BVU_0420Help
Entry
BVU_0420          CDS       T00546                                 

Definition
CysQ, sulfite synthesis pathway protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
bvu  Bacteroides vulgatus
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bvu00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    BVU_0420
Enzymes [BR:bvu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     BVU_0420
Transfer RNA biogenesis [BR:bvu03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    BVU_0420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(604091..604915)
Genome map
AA seq 274 aa AA seqDB search
MEVNTMQTEYILKAMDAALAAGKEILNVYNDPSSDFQVERKADNSPLTLADRKAHETIMT
YLQETDYPVLSEEGKHLPYEKRAQWDTLWIVDPLDGTKEFIKRNGEFTVNIALVKEGVPV
FGVIYVPVKETLYWGEVATGAYKMEGVTGRAGRSLEEMKASAFRMPCAETNEVFVIVASR
SHLSAETEEYIEEKRKIYPHVELVSVGSSIKICKVCEGLADEYPRFAPTMEWDTAAGHAI
AKASGAEIYQAGKEEPLKYNKPDLLNPWFVVKRN
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggaagtaaacactatgcagactgaatatatattaaaagcgatggatgcggctttagct
gccggtaaggaaattctgaacgtttataatgatccttcttctgattttcaggttgaaagg
aaagccgataattctccactgactcttgcagaccgtaaggcgcatgaaaccattatgact
tatttgcaggaaacagactatccggtattgagtgaggaaggaaagcatttgccttacgag
aaacgggcgcaatgggatacgttgtggatagtcgatcccttggatggaacaaaggaattt
ataaaacggaatggggaatttactgtcaatattgctttggtaaaagaaggagttcctgtt
tttggagtgatttatgttcctgtcaaagaaacgctttattggggtgaagtggcaaccggc
gcttataaaatggaaggagtgaccggacgtgcaggccgttcactggaagaaatgaaggca
tcggcatttcgtatgccctgtgccgaaacaaatgaagtttttgtcattgttgcttcccgt
tcccatctgtcggccgaaacggaagagtatattgaggaaaagcgaaagatataccctcat
gtggagttggtgtctgtaggcagttccatcaagatttgcaaagtgtgtgagggactggcc
gatgaatatccccgttttgctcctaccatggagtgggatacggctgccggtcatgccata
gccaaggcatccggagcagaaatatatcaggcgggaaaagaagaaccgttgaaatataac
aagccggacttgctgaatccttggtttgtcgttaaacgaaattaa

DBGET integrated database retrieval system