KEGG   Bacteroides vulgatus: BVU_0466Help
Entry
BVU_0466          CDS       T00546                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bvu  Bacteroides vulgatus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bvu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BVU_0466 (tpiA)
   01230 Biosynthesis of amino acids
    BVU_0466 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BVU_0466 (tpiA)
   00051 Fructose and mannose metabolism
    BVU_0466 (tpiA)
   00562 Inositol phosphate metabolism
    BVU_0466 (tpiA)
Enzymes [BR:bvu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BVU_0466 (tpiA)
Exosome [BR:bvu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BVU_0466 (tpiA)
  Exosomal proteins of bladder cancer cells
   BVU_0466 (tpiA)
  Exosomal proteins of melanoma cells
   BVU_0466 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(656295..657050)
Genome map
AA seq 251 aa AA seqDB search
MRKNIVAGNWKMNKNLQEGIALAKELNEALAADKPNCDVVICTPFIHLASVTPIVDKAVI
GVGAENCADKVSGAYTGEVSAEMVASTGAEYVILGHSERRAYYHETVEILEEKVKLALAN
NLKPIFCIGEVLEEREANKQNEVVAAQLASVFSLSAEDFSKIILAYEPVWAIGTGKTATA
EQAQEIHAFIRSLIADKYGKEVADNTSILYGGSCKPSNAKELFANPDVDGGLIGGAALKV
VDFKGIIDAFK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaacattgttgcaggaaactggaaaatgaacaagaaccttcaggaaggtatt
gctctggcaaaagaattgaatgaagctttggctgctgacaaacctaattgtgatgtggta
atctgtactccgtttattcacttggcttctgttactcctattgttgacaaggctgtaatt
ggtgtaggtgcagaaaactgtgcagataaagtatcaggtgcatataccggtgaggtttct
gctgaaatggtagcttctacaggtgctgaatatgtaattctgggtcactcggaacgtcgt
gcttactatcacgaaactgtggaaatcctggaagaaaaagttaaattggctttggctaat
aacttgaagcctatcttctgcatcggtgaggtattggaagagcgtgaagctaacaaacaa
aatgaagtggttgctgctcagttggcatcggtattctctttgtctgccgaagattttagt
aagattatcttggcttacgaaccggtttgggctattggtacaggtaagactgctactgct
gaacaggctcaggaaatccacgcgtttatccgttctttgattgccgacaagtatggtaaa
gaagttgctgataatacttcaatcctttatggtggaagctgcaagccttctaatgctaaa
gaattgtttgctaaccctgacgtagacggtggcttgattggtggtgctgctttgaaagtt
gttgacttcaaaggcattatcgatgcattcaaataa

DBGET integrated database retrieval system