KEGG   Bacteroides vulgatus: BVU_0495Help
Entry
BVU_0495          CDS       T00546                                 

Definition
beta-glycosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bvu  Bacteroides vulgatus
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:bvu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BVU_0495
Enzymes [BR:bvu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BVU_0495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(691058..693406)
Genome map
AA seq 782 aa AA seqDB search
MKKLLTLLLAVLLLAGCAGNKPGTFEAGKNTFLLNGKPFVVKAAEVHYPRIPREYWEHRI
EMCKALGMNTLCLYVFWNLHEETPGKYDFTGNKDIAAFCKLAQKHGMYVIVRPGPYVCAE
WEMGGLPWWLLKNDSVQLRTLDPFYMQHVGAFMHEVGKQLQDLQITRGGNIIMVQVENEY
GSYGTDKPYVSAIRDTVRAAGFTEVPLFQCDWSSNFLNNGLDDLLWTINFGTGADIDKQF
AKLKEVRPDAPLMCSEFWSGWFDHWGRKHETRDGQIMVDGLKEMMDKGISFSLYMTHGGT
TFGWWGGANNPAYSAMCSSYDYDAPISEAGWTTDKYFALRDMLKDYLDEGQTLPKVPEAL
PVMEIPAIKFTQIAPLVDNLSEPKQTEEIQPMEKFDQGWGSILYRTHLPEDVKAGTVLKI
TEQHDWTQVFADGKLLGRLDRRGGEQELTLPALKAGTQLDLLVEAMGRVNFDKSIHDRKG
ITEKVELVNGKNAETLKGWTVYNLPVDYEFVSSRNFQDMNSSAACGIEKNDESVPAYYRA
TFTLDKVADTFLNMESWGKGMVWVNGHAMGRFWEIGPQQTLFMPGCWLKKGVNEIIVLDL
KGPKEATIVGLNKPILDMLRVAVPETHRKQGQTIKLEKETPVSAGTFKPGNGWQEVKVPV
TKGRYFCLEGLSSFDNTNIAAIAEFDVLDEKGQKISRENWKIVYADSEETRSGNRTADKI
YDLQESTFWQTVDNTAYPHQVVIDLGKEYNVTGFRILPRAEQGAPGMIKDYKVYVKATGF
GY
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaattactgactttgttgctggcggtcctgctgctggcaggatgtgccggcaat
aagcccgggacattcgaagcgggtaagaatacctttctgctgaatgggaaaccgttcgtg
gtcaaagcggcagaggtgcattatccgcgtattccccgtgaatactgggaacatcgtatt
gaaatgtgtaaagcattgggcatgaatacgctttgtctgtatgtcttttggaatttgcat
gaggaaactcccggtaagtatgattttacaggtaataaagatattgcagctttctgtaaa
ttggctcagaagcatggtatgtacgtcattgtgcgtcccggtccgtatgtatgtgcggaa
tgggaaatgggtgggctgccttggtggctgctgaagaacgacagcgtgcagcttcgtact
ctcgatcctttctatatgcagcacgtgggagcctttatgcatgaagtgggcaagcagttg
caggatttgcagattacccgtggtggtaacatcatcatggtgcaggtggaaaacgaatat
ggttcgtatggcacggacaagccctatgtgtctgccatccgtgatacggtacgtgccgca
ggctttactgaagtgcctttgttccaatgtgactggagttctaatttcctgaataatggt
ttggatgatttgctttggactataaattttggtacgggagctgatatcgacaagcagttt
gccaaactgaaagaagtacgtcccgacgctccgttgatgtgcagcgagttctggagcgga
tggtttgatcactgggggcgcaagcacgaaacccgtgacggacaaatcatggtggatggc
ctgaaagagatgatggacaaaggtatttctttcagtttgtacatgacccacggaggaacg
acctttggctggtggggtggtgccaataatccggcttactcggctatgtgcagcagctat
gactatgacgctcctatcagcgaagcaggctggaccaccgacaagtattttgctttacgt
gatatgttgaaggactacttggacgaaggacagacattgcctaaagttcctgaagcttta
ccggttatggaaatccctgccattaaattcactcaaatagctccgttggttgacaatctg
tccgaaccgaagcagacagaggaaatccagccgatggagaaatttgaccaaggctgggga
agtatcctgtaccgtacccatttgccggaagatgtgaaagcgggaaccgttctgaaaatc
accgaacagcatgactggacacaggtttttgccgacgggaaactgttggggcgtctggat
cgccgtggtggagaacaggaacttacactgcctgcattaaaagccggtacacagcttgat
ttattggtggaagccatggggcgtgtgaactttgacaagtccattcacgaccgcaaggga
attaccgagaaagtggaactggtgaacggtaagaatgctgaaacgttgaaaggctggact
gtttataatcttcccgtagattatgaatttgtatcttcccggaactttcaggatatgaac
tcgtctgccgcctgtggcatagagaaaaatgatgaaagtgttccggcctactatcgcgct
acttttaccttggataaggtggctgatacattcctgaacatggagtcttggggaaaaggt
atggtatgggtgaacggtcatgccatgggacgtttctgggaaatcggtcctcaacaaacc
ctgttcatgccgggttgttggctgaaaaaaggagtgaatgaaatcatcgttcttgacttg
aaaggcccgaaagaggcaaccattgtcggattgaacaaacctatcctggatatgcttcgt
gtggctgttcctgaaacgcatcgtaaacaggggcagaccatcaaactggagaaggaaaca
ccggtatctgccggtactttcaaaccaggtaacggttggcaagaagtgaaagttcctgtt
acgaaaggacgttacttctgtctggaagggctgtcttcttttgataataccaacattgcc
gccattgcggagtttgatgtgttggatgagaaaggacagaaaatctctcgtgaaaactgg
aagattgtttatgccgacagcgaggaaacccgtagcggtaaccgcacagccgacaagatt
tatgacctgcaagaaagtactttctggcagacggtagataatacggcttatcctcatcag
gtggtgatagatctcggcaaagaatataacgtgaccggtttccgtattctgccacgtgcg
gaacagggagctcccggcatgattaaagattataaggtgtatgtaaaagcaaccggtttc
ggttattga

DBGET integrated database retrieval system