KEGG   Bacteroides vulgatus: BVU_0498Help
Entry
BVU_0498          CDS       T00546                                 

Definition
beta-glycosidase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
bvu  Bacteroides vulgatus
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bvu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    BVU_0498
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BVU_0498
Enzymes [BR:bvu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     BVU_0498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(698086..699594)
Genome map
AA seq 502 aa AA seqDB search
MKKNKFLFCIGLLLTVATIVNAQSVTWISSTEGNVWQKSKVKLQSKSEQNPVLQVDGTEN
GVAFKNWGTTFNELCWDALGLLTRTEQDEILYNIFSPQGDLRITRGRISMGANDYARSWY
SCDEVEGDFELRYFNINRDKQTIIPFIRAAQKYNPNLTFWISPWCPPSWMKINGDYPVLS
SPFNSLSEKQNYLLYGATGGQVDENEMKLTGARDGVFPRQLATTDFMIQDPRYLQTYADY
FCRFIDAYKEQGIPIDMVMYQNEAYSYTPYPGCAWTATGTIRFNKEYLAPTLRQMHPEVK
LYLGTFNTNRQDHVETILADTALCNCIRGMGFQWEGREILPSIRKQHPEWEYICSESECG
WGSFDWKAAEHTFELINHYLGNGCCEYNFWNCILTDKGESPWGWKQNALIRVDSEKRTFV
YTPEYYAVKHYSKMVAPGSKILQYKAKGEDNQPVIIFLTPENQYLVVAGNFNGKQQNLSV
KLAGKYLEVTLQPHSLNTFYTK
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaataaattcttattttgtatcggtctgttactgactgttgcgacgattgta
aatgcacagtctgtgacttggattagtagtaccgaaggcaatgtatggcaaaaatcaaaa
gtgaagttgcagtcaaaatcagaacaaaatcctgttttacaggtagatggaacagagaac
ggtgttgctttcaagaattggggaactactttcaatgaactttgttgggatgctcttggg
ttattaactcgtactgaacaagatgaaatattgtataatatattttctccgcaaggtgat
ttacggattacgcgtggacgaatttcgatgggagccaatgattacgctcgttcttggtat
agttgtgacgaagtggagggtgactttgaattgagatattttaatattaatcgtgataaa
cagactattattcctttcatacgtgctgcacaaaaatataatccgaatcttacattttgg
atatcaccttggtgtcctccaagctggatgaaaataaatggagattatccggttttaagt
agtccgtttaatagtttgtcagagaaacagaattatttattatatggtgctacaggcggt
caggttgatgagaatgaaatgaagttgaccggtgcccgtgatggagtttttcctcgccaa
cttgcgacaactgactttatgattcaagatccacgttatttgcagacttatgcagattat
ttttgtcggtttatagatgcctataaagaacaaggaattcccattgatatggtaatgtat
cagaatgaagcgtacagttacactccttatcctggttgtgcctggactgccaccggtacg
attcgtttcaataaagaatatttagctcctactttgaggcaaatgcatcctgaggtgaag
ctttatttaggtacttttaatacgaatcgccaagatcatgtagaaacaattcttgctgat
acggctttatgtaattgtattcgtggtatgggatttcaatgggaaggacgtgaaatactt
ccttccataagaaaacagcatcccgaatgggaatatatctgttcggaaagcgaatgcggt
tggggtagttttgattggaaggcagcagaacatacatttgagttgataaatcattattta
gggaatggatgttgtgaatataatttttggaattgtattttgaccgataaaggtgaaagt
ccgtggggatggaaacagaatgcgttgattcgtgtggattcggaaaagcgtacgtttgtt
tataccccggagtattatgcagtaaagcattatagcaaaatggtggctccaggatcaaaa
atcttacaatacaaggcaaagggggaggataaccaaccagtcattatattcctgactcct
gagaatcagtatttggtagtggcggggaattttaatggcaaacaacagaatttgagtgta
aaactggcgggaaaatatttggaggtgacgttgcagccccattctctaaatacattttat
acaaaatga

DBGET integrated database retrieval system