KEGG   Bacteroides vulgatus: BVU_0517Help
Entry
BVU_0517          CDS       T00546                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bvu  Bacteroides vulgatus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bvu00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
735735..736592
Genome map
AA seq 285 aa AA seqDB search
METKTVKYINVNGKLMDLSHPQVMGILNVTPDSFYAGSRQQTEKDIINRTSQIIEEGASI
IDIGAYSSRPNAEHISPEEEMRRLRTGLEIINRYHPGCVVSVDTFRADVAQMCVEEYGVA
IINDIAAGEMDPQMFDMIARLGVPYIIMHMQGTPQNMQMNPHYDNLLKEVFLYFSEKVQK
LRDLGVKDIILDPGFGFGKTVEHNYQLMNHLEEFSLFELPLLVGISRKSMIYKLLGGTPD
DALNGTTVLDTISLLKGADILRVHDVKAAVETVKIVQKMKDSAAF
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaaaccgtcaaatatattaatgttaatgggaaactgatggatctctcccat
ccgcaagtaatgggaatcctgaatgtgacacccgattctttctatgccggcagccggcag
caaacggaaaaagatattatcaaccgtacctcccaaataatagaagaaggagcttccatc
attgatataggtgcctattcctcacgtcccaatgccgagcacatcagccccgaggaagag
atgcgccgtctgcgtaccggactggaaatcatcaatcgctatcatcccggttgtgtggtg
tccgtggacactttccgtgcggatgtagcccagatgtgtgtagaggagtacggagtggca
atcatcaatgacattgccgccggagaaatggacccgcagatgttcgacatgattgccagg
ctgggagtaccttatattattatgcatatgcaaggcacgccgcaaaatatgcaaatgaat
ccgcattatgacaatctgttgaaagaagtctttctctatttctcggaaaaagtacagaaa
ttacgcgacttaggagtaaaagatattattctggatcctggtttcggtttcggaaaaaca
gtggaacataattaccagttgatgaatcatttggaagaattcagcctgttcgaactaccg
ttactggtcggcatatcacgtaaatcaatgatttacaagctactaggcggaacccctgat
gatgccttgaacggaacaacagtgctggataccatttccctactaaaaggagcggatatt
ctcagagtgcacgatgtaaaagctgctgtagaaaccgtgaagatagtacagaagatgaaa
gactctgctgccttttaa

DBGET integrated database retrieval system