KEGG   Bacteroides vulgatus: BVU_0517Help
Entry
BVU_0517          CDS       T00546                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bvu  Bacteroides vulgatus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bvu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BVU_0517
Enzymes [BR:bvu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     BVU_0517
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
735735..736592
Genome map
AA seq 285 aa AA seqDB search
METKTVKYINVNGKLMDLSHPQVMGILNVTPDSFYAGSRQQTEKDIINRTSQIIEEGASI
IDIGAYSSRPNAEHISPEEEMRRLRTGLEIINRYHPGCVVSVDTFRADVAQMCVEEYGVA
IINDIAAGEMDPQMFDMIARLGVPYIIMHMQGTPQNMQMNPHYDNLLKEVFLYFSEKVQK
LRDLGVKDIILDPGFGFGKTVEHNYQLMNHLEEFSLFELPLLVGISRKSMIYKLLGGTPD
DALNGTTVLDTISLLKGADILRVHDVKAAVETVKIVQKMKDSAAF
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaaaccgtcaaatatattaatgttaatgggaaactgatggatctctcccat
ccgcaagtaatgggaatcctgaatgtgacacccgattctttctatgccggcagccggcag
caaacggaaaaagatattatcaaccgtacctcccaaataatagaagaaggagcttccatc
attgatataggtgcctattcctcacgtcccaatgccgagcacatcagccccgaggaagag
atgcgccgtctgcgtaccggactggaaatcatcaatcgctatcatcccggttgtgtggtg
tccgtggacactttccgtgcggatgtagcccagatgtgtgtagaggagtacggagtggca
atcatcaatgacattgccgccggagaaatggacccgcagatgttcgacatgattgccagg
ctgggagtaccttatattattatgcatatgcaaggcacgccgcaaaatatgcaaatgaat
ccgcattatgacaatctgttgaaagaagtctttctctatttctcggaaaaagtacagaaa
ttacgcgacttaggagtaaaagatattattctggatcctggtttcggtttcggaaaaaca
gtggaacataattaccagttgatgaatcatttggaagaattcagcctgttcgaactaccg
ttactggtcggcatatcacgtaaatcaatgatttacaagctactaggcggaacccctgat
gatgccttgaacggaacaacagtgctggataccatttccctactaaaaggagcggatatt
ctcagagtgcacgatgtaaaagctgctgtagaaaccgtgaagatagtacagaagatgaaa
gactctgctgccttttaa

DBGET integrated database retrieval system