KEGG   Bacteroides vulgatus: BVU_0553Help
Entry
BVU_0553          CDS       T00546                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
bvu  Bacteroides vulgatus
Pathway
bvu00330  Arginine and proline metabolism
bvu00332  Carbapenem biosynthesis
bvu01100  Metabolic pathways
bvu01130  Biosynthesis of antibiotics
bvu01230  Biosynthesis of amino acids
Module
bvu_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bvu00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BVU_0553
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    BVU_0553
Enzymes [BR:bvu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     BVU_0553
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ABR38263
UniProt: A6KXU9
Position
complement(783582..784664)
Genome map
AA seq 360 aa AA seqDB search
MAVQFTRIAVKIGSNVLARKDGTLDVTRMSALVDQVAELRKAGVEVILISSGAVASGRSE
IKPSKKLDSVEQRQLFSAVGQAKLINRYYELFREHGIPVGQVLTTKESFGTRRHYLNQRN
CMMVMLENGVIPIVNENDTISVTELMFTDNDELSGMIASMMDMQALIILSNIDGIYNGSP
STPGTQVIREVEQGKDLSDYIQTEKSGFGRGGMLTKTTIARKVADEGITVIIANGKKDHI
LVDLLQHPAETVCTRFIPAEGGVSSVKKWIAHSEGFAKGELHLNEQAVKVLKGQKAVSLL
PVGVVRIEGEFEKDDIVKIIDHRGRQIGVGRIGFDSAEARALQGKHGQKPMVHYDYLYLD
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggcagttcagtttacaagaatagcagtaaagatcggtagtaatgtgttggcgcgtaaa
gacggtacgctggatgtgacgcgtatgtcggcattggtagaccaggtggcggaattgcgc
aaagccggggtggaagtcattctgatttcatccggggcggtagcttcgggacgcagcgag
atcaagccttccaagaaattggatagcgtggagcaaaggcagcttttctcggcggtgggc
caggcaaaactgatcaaccggtactatgagctgtttcgcgaacacggtattcccgtcggg
caggtgctgactacgaaagaaagtttcggcacgcgccgtcattacctgaaccagcgcaac
tgcatgatggtgatgctggagaacggtgtcatacctatcgtaaatgagaatgataccatt
tcggtcaccgaactgatgtttacagacaatgacgagctttcgggaatgatcgcttccatg
atggatatgcaggcattaatcatactgagcaatattgacggcatatacaatggctctcct
tctacccccggtacgcaggtgatacgcgaggtggagcagggaaaggatctttcggactat
atacagacggagaaatcgggattcggccggggcggtatgctgacaaagactaccattgcc
cgtaaggtggccgatgagggcattaccgtcattatagccaatggcaagaaagaccatatc
ctggtcgatttgctgcaacatccggcagagacggtttgtacacgctttattccggcagaa
ggcggagtatccagcgtgaaaaagtggattgcccatagcgaaggctttgccaaaggcgag
ttgcatttgaacgaacaggccgtgaaagtgttgaaaggacagaaggcggtaagcctgctt
cctgtgggagtggtccgcatagaaggggaatttgaaaaagatgatatagtgaaaatcata
gaccaccggggcaggcagataggagtgggacgcatcggatttgattcggcagaagcgcgt
gcattgcaggggaaacatggacagaaacctatggtacactatgattatttgtatttggac
tga

DBGET integrated database retrieval system