KEGG   Bacteroides vulgatus: BVU_0736Help
Entry
BVU_0736          CDS       T00546                                 

Definition
alpha-glycosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
bvu  Bacteroides vulgatus
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bvu00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bvu00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:bvu00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1013984..1016152)
Genome map
AA seq 722 aa AA seqDB search
MNNTMKERLLFLICFLCISFMLKAADKPVIKISTENVDLIYRVGDNGRLYQSYLGKRLNH
ATDIAHLPQGSEAYLTHGMEDYFEPAIHIVHNDGNPSTLLKYVSHTRNQVSPGVDEVVIT
MQDDKYPVTVKLHYVAYQKENLIKTFTEISHREKKPVQLHKYASSMLHLNRANYFLTEFS
GDWASEAHVKEQPLEFGKKTIDTKLGARANMFCSPFFQLALDGKSEENQGEVLVGTLGWT
GNFSFVFEVDNKNELRVISGINPYASEYSLKPNEIFRTPDFYFTYSFKGKGQASRNFHDW
ARKYQVKDGNQTRMTLLNNWEATYFDFDEAKLVKLMDDAVELGVDMFLLDDGWFANKYPR
SGDHQGLGDWDETADKLPHGIGYLTEAAKKKGIKFGIWIEPEMVNPKSELYEKHKDWVIH
LPNRDEYYFRNQLVLDLSNPKVQDYVFGVVDNLMTKYPDIAFFKWDCNSPITNIYSVYLK
DKQSHLYIDYVRGLYNVLERVKAKYPDLPMMLCSGGGGRSDYEALSYFTEFWPSDNTDPI
ERLFIQWGFSQVFPAKTMCAHVTTWNKNSSVKFRTDVAMMCKLGFDIKLADMSKDDETYC
RTAVQNYNRLKPVVLEGDMYRLVSPYGSNHTSTMYVGKDKDKAVVFAFDIHPRYAEKILP
VRLQGLDADKMYRVKEINLMPGANSSLSGNGEVFSGEFLMNVGLNLFTTQQLNSRVIEVV
AE
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgaataataccatgaaagaaagattgctcttcttgatatgttttttatgcatatcattt
atgttaaaggcggcggataagccagtaattaaaattagtacagaaaatgtagaccttatt
taccgggttggtgataatggacgtctatatcaaagttatttgggaaagaggttgaatcat
gctacagatattgcccacttgccgcagggcagcgaagcatatcttactcatggcatggaa
gattattttgaaccggctattcatatagtgcataatgacggcaatccttctactttgtta
aaatatgtatctcatactcggaatcaagtgtcgccgggggtagatgaagtagtgattact
atgcaggatgataaatatcctgtaactgtaaaacttcattatgtggcttaccagaaagaa
aatctaataaagactttcactgaaatcagtcatcgggaaaagaaacctgtgcagcttcat
aagtacgcgtcttccatgttgcacttgaatcgtgccaactatttcctgactgaattctcg
ggagactgggccagtgaggcgcatgtgaaggaacagcctttggaatttggcaagaaaacg
attgatactaaattgggagcacgtgccaatatgttctgctctcctttcttccaacttgca
ttggatggaaaatcagaagagaaccaaggtgaagtgttggtcggaacattaggatggaca
ggtaatttcagttttgtattcgaagtagataataagaacgaactgcgtgttatttcgggt
attaatccgtatgcttcggaatatagtctgaaaccgaatgaaatcttccgtactcccgat
ttttattttacttacagttttaaaggtaaaggacaggctagtcgtaatttccatgattgg
gcccgtaagtatcaggtaaaggatgggaaccagactcgtatgactttgttgaataattgg
gaagccacctattttgattttgatgaagcgaaattggtgaagttgatggatgatgcagta
gaactgggtgtggatatgtttttgttggatgatggttggtttgccaacaagtatccgcgc
agtggtgatcatcaagggttaggtgactgggatgaaacggctgacaagcttcctcatggc
attggttatctgacggaagccgccaagaaaaaaggtataaagttcggtatctggattgaa
ccggaaatggtgaatcctaagagtgagttgtatgaaaagcataaagactgggtgattcat
cttccgaaccgtgacgagtattatttccgtaaccagttggttctggatttgagtaatccg
aaagtacaggattatgtgttcggagttgtggacaatttgatgacaaaatatcctgatatc
gctttcttcaaatgggattgcaatagccctattacaaatatttactctgtttatttgaaa
gacaagcagtcacatttatatattgattatgtgcgtggcttgtataatgtattggaacgt
gtgaaagcaaaatatcctgatctgccgatgatgctttgttccggtggcggtgggcgttcg
gattatgaggctttgagctattttacagaattctggcctagtgataataccgatcctatt
gaacgtttatttattcagtggggattttcacaggtgtttccagccaagacaatgtgcgct
catgttaccacatggaataagaatagcagtgtgaaattccgtacggatgtggctatgatg
tgcaaactcggttttgatataaaattagcggatatgagtaaggatgatgaaacttattgc
cgtactgctgtacagaattataaccgtttgaaaccggtcgttctggaaggcgatatgtac
cgtttggtatctccttatggcagtaatcatacctctactatgtatgtgggcaaagataag
gataaagcagttgtatttgctttcgatattcatccccgttatgcggaaaaaatattgccg
gtgcgtttgcaggggcttgatgcagacaaaatgtatcgtgtgaaagaaatcaacttgatg
cccggagccaattcttctttatcaggcaatggtgaggttttctctggagaattcttgatg
aatgtaggattgaatctatttactacacagcaactcaacagtcgtgtaattgaagtagta
gctgaatga

DBGET integrated database retrieval system