KEGG   Bacteroides vulgatus: BVU_0760Help
Entry
BVU_0760          CDS       T00546                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
bvu  Bacteroides vulgatus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bvu00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BVU_0760
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BVU_0760
  Lipid metabolism
   00071 Fatty acid degradation
    BVU_0760
  Amino acid metabolism
   00350 Tyrosine metabolism
    BVU_0760
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BVU_0760
   00626 Naphthalene degradation
    BVU_0760
Enzymes [BR:bvu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BVU_0760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1065609..1066781
Genome map
AA seq 390 aa AA seqDB search
MKANPVFSLYIPTKLVFGCEEIKKLSSEKLPGKKALVVISSGTSMRKYGYLERVLAQLRL
NNVETLVYDKILPNPIKEHVMEAAAICREEKCDFVVGLGGGSSIDSAKSIAVMACNDGDY
WDYVSGGSGKGRPVTKALPIIAIPTTAGTGTEMDPWTVITHETAQEKIGFGCQLTFPTLS
IVDPELMVSIPPHLTAYQGFDAFFHAAEGFIANCATPISDLYALEAIRLIYKYLPVAVAD
GKNLKARAKIAWASTLAGMVEATSSCTSEHSLEHAMSAYYPQLPHGAGLIALSEAYFETF
RHDCTKRYMKMAEMMTQKKSNRPSDFIDALITLQKECKVHSIKLSEFGIQSEDFPKFLQN
ARDTMGGLFTLDPRPITDEEILHIFKNSYK
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaaatcctgtatttagtttatacatccctaccaaattagtatttggctgcgaa
gaaatcaagaaattatccagtgaaaaattaccgggaaaaaaggcactggtcgtcatctca
tccggaacttccatgcgaaaatatggatatttggagagagtacttgcccaattaagactg
aataatgtagaaacactggtttacgataaaatccttcccaaccccatcaaagaacacgtc
atggaagcagccgccatctgccgggaggaaaagtgcgactttgtagtaggactgggaggc
ggaagttccatcgactccgccaaaagtatagctgttatggcctgcaacgatggtgactac
tgggattatgtatcagggggtagtggtaaaggacgccctgttaccaaagcacttcccatt
atcgccatacctactaccgccggaaccggaacagaaatggatccatggacagtgattacc
cacgaaacggctcaagaaaagataggcttcggttgtcagctgactttccctaccttatct
attgtagacccggaactgatggtttccattcctccgcacctcaccgcctatcaagggttc
gatgcattcttccatgccgcagagggttttatcgccaattgtgcaacacccatcagtgat
ctttacgccttagaagccatccgtctgatctacaaatatctgccagtagccgtagccgac
ggaaagaatttgaaagcgcgtgccaaaattgcttgggccagcaccttggcaggcatggtg
gaagccacttcaagctgcacttccgaacattcattagaacatgccatgagtgcttattat
ccacaacttcctcatggagcaggactcattgccttgtctgaggcatacttcgaaactttc
cggcatgactgtacaaaacgttacatgaaaatggctgaaatgatgacccagaaaaagagc
aaccgtccgtccgatttcattgatgcattgattacactgcaaaaagaatgtaaagtacat
tctatcaaactgagcgaatttggtatccaatccgaagatttccccaaattcctgcaaaat
gcaagagatacgatgggaggactgttcactctcgacccacgcccgattacagacgaagaa
atcctgcatatctttaaaaattcttataaataa

DBGET integrated database retrieval system