KEGG   Bacteroides vulgatus: BVU_0997Help
Entry
BVU_0997          CDS       T00546                                 

Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
bvu  Bacteroides vulgatus
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bvu00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:bvu00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:bvu00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1316691..1320020
Genome map
AA seq 1109 aa AA seqDB search
MTTLFKFLISAAVCAYSTQVLHAEDTKLPYWKDIQTVAVNKEYPRTAFMTYDNRNQALTG
EYENSPYYKLLNGTWNFYYADAYKDLPANIEQPDANIAWKEIKVPGNWEVQGYGVAIYTN
HGYEFKPRNPQPPQLPETNPVGVYQRDIEIPADWDGRDIFLRLEGAKSGVYVYVNGQEVG
YSEDSKNPAEFLINNYLKPGKNSLVIKIFRWSTGSYLECQDFWRMSGIERDVFLFSQPKT
HIKDFNVVSTLDDTYKNGIFKLNVDVTNHTAANKEVTVAYELLDAAKKVVAEGNTPCPVT
ADGQKSISFEAALSNVKTWTSEHPNLYRLLISLKDGEKTSEIIPYTVGFRRFEIKPTDQI
AENGKPYVCLFVNGQPIKLKGVNIHEHNPETGHYVPEELMRKDFTLMKQNNINSVRLCHY
PQDRKFYELCDEYGIYVYDEANIESHGMYYNLSRGGTLGNHPEWLKPHMDRTINMYERNK
NHPSVAIWSLGNEAGNGYNFYQTYLWLKEREVKGMNRPVNYERALWEWNTDMYVPQYPSA
AWLEEIGKKGSDRPIAPSEYSHAMGNSNGNLAAQWRAIYKYPNLQGGYIWDWVDQGILET
DENGRTYWAYGGDYGTNAPSDGNFLCNGIVAPDRTPHPAMTEVKYAHQNVGFEAIDPAAG
KFLVKNRFYFTNLKKYMISYTVKANGKTIKGGKVSLDIEPQGSKELNINLNGLKPKAGTE
YFVDFVVTTTEPEPLIPAGHDIASEQFRLPIEPLAMTGHKASGKTTVSTDGDIITVLSPR
MQFVFNKKSGLVTSYKVNGTEYFAEGFGIQPNFWRAPTDNDYGNGGPKREQIWKQSSKNF
NVADVTTTTDGNKTVLTVNYLLAAGNLYIMKYTIYPDGVVHAGITFTSTDMKAADTEVSE
ATLMATFTPGQDAQRLASSKLNVPRIGVRFHLPSDMNQVEYFGRGPGENYIDRNASSFVD
LYRTTADQMYTNNYVRPQENGHRTDTRWVELTRKGGKGLLIRADSTIGFNALRNSVEDFD
SEEAISRPRQWTNFTPEEVANHNEEKAKNVIRRMTHVNDITPRNFVEVCIDMKQQGVAGY
DSWGDRPLPEHTLPANKEYHWGFTLMPVK
NT seq 3330 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccttatttaaattcctgatcagcgctgctgtatgcgcatattcaacacaagtt
cttcatgcggaagatacaaaactaccttattggaaagatattcagaccgtagccgtcaac
aaggaatatccacgcacagctttcatgacttacgacaaccggaaccaggcactgaccggc
gagtatgagaacagcccttattacaaactactaaacggtacatggaacttttattatgca
gatgcatacaaagatctgcctgccaacattgagcaaccggatgccaacatagcctggaag
gagattaaagtacccggcaactgggaagtacagggctacggagtggccatctacaccaat
catggatacgaattcaaacccagaaatccacaaccgccgcagttacccgaaaccaatccg
gtcggtgtgtatcagcgtgatatcgaaattcccgccgattgggatggacgcgacatattc
ctccgtttggaaggagcaaaatccggtgtatacgtgtatgtcaacggacaggaagtggga
tacagcgaagactccaagaatccggcagaattcttaatcaacaactacctgaaacccggc
aaaaactcgctggtcatcaaaatattccgctggagtaccggttcttatctggaatgccag
gacttctggcgcatgagcggtattgaacgtgatgtattcctgttctcacagcccaaaacc
cacatcaaagatttcaatgtggtgtctacactggacgacacttataagaatggtatcttc
aaactgaatgtggacgtaaccaaccatacagcagccaacaaagaggtaaccgtagcatac
gaattgctggatgccgcaaagaaagtggttgcagaaggtaacaccccctgtcctgttaca
gcagacgggcagaagagcatctcttttgaagccgccctcagcaacgtcaagacctggaca
tcagaacaccctaacctgtatcggttactgatatctctgaaagacggagaaaaaacaagc
gaaatcattccttatacggtaggtttccgccgtttcgagatcaaaccaaccgatcagata
gccgaaaacggcaaaccatacgtttgcttgttcgtcaacggccaacccatcaagctgaaa
ggtgtaaacatacacgaacataatcccgaaacaggacattatgttcccgaagagctgatg
cgcaaggacttcaccctgatgaaacagaacaacatcaacagcgtgcgcctctgccactat
ccgcaagaccgcaagttctatgaattgtgtgatgaatatggtatctatgtatatgatgaa
gccaacatcgaaagccacggtatgtattataacttaagccggggcggaacattgggcaac
catcccgaatggctgaagccgcacatggaccgtaccattaatatgtacgagcgtaacaaa
aaccatccctctgtagccatctggtcattaggaaacgaagccggaaacggttataatttc
tatcagacctatttatggctgaaagaacgcgaagtaaaaggcatgaaccgtcctgtaaat
tatgaacgcgccctttgggaatggaacacagatatgtatgtaccccaataccccagtgcc
gcctggctggaagaaataggcaagaaaggcagcgaccgtcccatcgcaccatccgaatat
tcacacgctatgggcaattccaatggtaatctggcagcacaatggagagcaatctacaag
tacccgaacctgcaaggcggttacatttgggactgggtagaccaaggtattctggaaaca
gacgaaaatggacgtacctactgggcctacggaggtgattacgggaccaatgcacccagc
gacggaaacttcctatgcaatggaatcgtagctccggaccgcactccgcatccggccatg
acagaagtgaaatatgcacatcagaatgtaggtttcgaagccatcgacccggctgccggc
aaattcctggtaaaaaaccgtttctacttcaccaacttgaaaaagtatatgatcagttat
accgtaaaggcaaacggaaaaacaatcaaaggcggaaaagtatcattagatatcgaaccg
caaggttccaaagaactgaacatcaacctcaacggattgaaacccaaggccggcacagaa
tattttgtagattttgtagttaccaccacagaaccggagcccttgattcctgcaggacac
gatattgcttccgaacaattccgcctgcccatagaaccattggctatgaccggacataaa
gcaagcggcaagactaccgtcagcacggatggtgacatcatcaccgtattatcaccacgt
atgcagttcgttttcaacaagaaaagcggactcgtgacttcatacaaagtaaacggtaca
gaatatttcgctgaaggttttggtattcagcctaacttctggcgcgcaccgacggacaat
gattatggtaacggtggccctaagcgcgagcaaatatggaaacagtccagcaagaatttc
aatgtagcagatgttaccacaacaacagacggcaacaagaccgtattaacagtcaattac
ctactggcggcaggcaatctgtacatcatgaaatataccatctatcccgacggtgtggtt
catgcaggcatcacctttacttctaccgatatgaaggctgccgacacggaagtatcagaa
gctaccttaatggccactttcacaccgggacaggatgctcaacgccttgcctcttccaaa
ctgaacgtaccacgtatcggtgtacgtttccatttgccatccgatatgaaccaggtagaa
tacttcggacgcggaccgggtgaaaactacatcgaccgtaatgcaagcagcttcgttgat
ctctaccgcactacagccgaccagatgtacaccaacaactatgtccgtccgcaagaaaac
ggacaccgcaccgacacccgttgggtagaactgacccgcaaaggcggaaaaggattgtta
atacgtgccgacagcactatcggattcaatgccctgcgcaactccgtagaggactttgac
tcggaagaagctatcagccgtccccgtcagtggactaacttcactcccgaagaagttgct
aaccataatgaggaaaaagctaaaaatgtaatacgccgcatgacacatgtcaatgatatc
accccacgtaattttgtggaagtatgtattgatatgaagcaacaaggtgtagccggttat
gacagctggggagaccgccctctgccggaacataccctacccgccaataaggaatatcat
tggggattcacattgatgccggtaaaataa

DBGET integrated database retrieval system