KEGG   Bacteroides vulgatus: BVU_1187Help
Entry
BVU_1187          CDS       T00546                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bvu  Bacteroides vulgatus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bvu00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1602256..1603005
Genome map
AA seq 249 aa AA seqDB search
MKIKKVLVSQPKPTSEKSPYYDIAEKYGVKIDFRPFIKVESLSAKEFRQQKVSILDHTAV
IFTSRHAIDHFFNLCTELRVTVPETMKYFCTSETIALYIQKYVQYRKRKVFFGATGKFAD
LVPSIVKHNTEKYLVPMSDVHNDEIKTLLDKNKIQHTEVVMYRTVSNDFTPEEEFDYDML
LFFSPAGINSLMKNFPEFDQKEIAIGCFGPATAKAVKDAGLRLDLEAPTVEAPSMTAALD
MFIRERNKD
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaataaaaaaagtcctcgtatctcagccgaagccgacttctgaaaagtcgccatac
tatgatattgctgagaagtacggtgtgaaaattgatttccgcccgttcatcaaagttgag
agcttgtcggcaaaagagttcagacagcaaaaagtctctattcttgatcataccgctgtg
atttttacatcgcggcacgctatcgaccatttcttcaatctgtgtacagaattgcgtgtt
actgtgcccgaaacaatgaaatatttctgtacgtccgaaaccattgctttgtacattcag
aaatatgttcagtatcgtaagcgtaaagtgttcttcggcgcgaccggtaaattcgcagat
ttggtgccttctatcgtaaagcacaacacggaaaaatatttggtgccgatgtctgatgta
cacaatgatgagatcaagactttattggataaaaataaaattcagcatacggaggtagtg
atgtatcgtacggtaagtaatgatttcactcctgaagaagagttcgattacgatatgctg
ttgtttttcagtcctgcaggaatcaattctttaatgaagaattttccggagttcgaccaa
aaggaaattgcgataggatgttttggtcctgctactgctaaagcggtaaaggatgccgga
ttgcggttggatctggaagctcctactgtagaggctccgtccatgactgcggcattggat
atgtttatccgcgagcgtaataaggattaa

DBGET integrated database retrieval system