KEGG   Bacteroides vulgatus: BVU_1387Help
Entry
BVU_1387          CDS       T00546                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bvu  Bacteroides vulgatus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bvu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BVU_1387
Enzymes [BR:bvu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     BVU_1387
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1856931..1859609)
Genome map
AA seq 892 aa AA seqDB search
MKLTFRIEYRTAWGEELGVILDGNNSEPIILRTPNGEHWEGEAEMPDLPACVPVSYRYGV
YRDGQCIRRESGTMAHLFCPGKKKNCHYILNDFWKDLPAESYLYSSAFSGDYQSETTIKV
TASADGSITFRALCPCLHHKRQVLAISGDCPALGNWDIQKTVLMEEIQPNEWTITLNVST
LEFPLSYKFVACNADSKQVEEWENHDNRMLNNPELKKGEIYLTPETEVHFTSSARKVAGT
AIPVFSLRSEKSFGVGDFGDLKKLIDWAAKTHQQAVQILPINDTTITHTWMDSYPYNSIS
IYAFHPMYIDLNQLGKMKDKEALAVFEARRQELNALPQIDYEAVNNAKRAYLKVMFQQTG
RKVLASAEFKKFFEENEHWLLPYAAFSYLRDLYGTPDFSQWPEHTEYKAEEIAALCAPDS
SCYEEIAFYYYTQYHLHIQLLDAGNYAREKGIIFKGDIPIGISRNSVEAWIEPYYFNMNG
QAGAPPDAFSVNGQNWGFPTYNWEVMEQDNYQWWQKRFRKMAEYFTAYRIDHILGFFRIW
EIPSHSVHGLLGQFVPALPMSVDEIQSYGLPFQKDFMTKPFINEEMLNKMFGDKAAFVKE
TFVQHAHDDIYEMRPEYDTQRKVEAYFSDKKDEESIHIREGVYALISNVLFVPDRKHPSM
YHPRIAVQNDFIFGRLDWKEKDAFNRLYNHYYYQRHNQFWYQEAMKKLPILTQATSMLVC
GEDLGMVPDCVPWVMDQLQILSLEIQRMPKNPKHEFGHVWEYPYRSVCTISTHDMSTLRG
WWEEDYEQTCRYYNHVMGHWGEVPVSAPGWVCEEIVRHHLECPSLLCILSFQDWLSIDEE
IRYPDVNAERINVPANPRHYWRYRMHLTLEELIKNKKFNEKLVEMIDTTGRF
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcacatttcgaattgaataccgtacagcctggggagaagaactgggggtgata
ctggacggaaacaatagtgaacctatcatccttcgcactccaaacggggaacattgggaa
ggtgaagctgaaatgccggacctccctgcatgcgtgcctgtttcctaccgctatggagta
tatcgtgacggacagtgcatccgccgtgaaagcggaaccatggctcatttgttttgcccc
ggaaaaaagaaaaactgccactacatattaaatgatttctggaaagaccttccggctgaa
tcttacttatacagttccgccttcagtggtgattatcagtctgagacaactataaaagtc
acagcaagcgccgatggaagcattactttccgggccttatgcccttgtctgcatcataag
cgtcaagtgctggctatcagcggagattgcccggctttaggcaattgggatattcaaaag
acggtcctgatggaagaaatacaaccgaacgagtggaccatcacactgaatgtttctact
ttggagtttccgctaagttataagttcgtagcctgcaacgccgacagcaagcaggtagag
gaatgggagaaccacgacaaccggatgcttaataatccggaattaaaaaaaggagaaatt
tacctgacaccggaaactgaagttcatttcacttcatcggcccgtaaggtggcgggaaca
gctatccctgtattttctctccgcagtgagaaaagttttggagtaggagatttcggagat
ttgaagaaactgatagactgggcggcaaagacccaccagcaagctgtacaaatcctccct
atcaacgatacgaccattacccatacctggatggattcttatccctacaacagcatttcc
atttatgcattccacccgatgtatattgacctgaaccagctgggtaagatgaaggataag
gaagcgctggctgtttttgaagcccgccggcaagaattgaacgctcttccccaaatagat
tatgaagcggtgaacaatgccaaacgtgcctatttgaaagtgatgttccaacaaaccgga
aggaaagtgctggcttcggccgaattcaaaaaattctttgaagaaaatgaacattggctg
ctgccatacgccgcattcagctatctaagagatctgtatggcactccggatttcagccaa
tggcctgagcatacagagtacaaggcagaagaaatagcagccttatgcgcaccggacagc
tcttgttatgaagaaatcgccttttactactacacacagtaccatttacatatccaatta
cttgatgcaggaaactatgcccgcgaaaaaggtattatctttaaaggtgatatccctatc
ggcatcagccgcaacagtgtggaggcatggattgagccgtattatttcaacatgaacggt
caggcaggcgcgccacccgacgcattctccgtgaacggacagaactggggctttcccacc
tataattgggaggtaatggaacaagacaactaccaatggtggcagaagcgtttccgcaaa
atggcagagtatttcacagcttaccgcatagaccatattcttggtttcttccgtatctgg
gaaatcccatctcattcggtacatggtttgctgggacagtttgtaccggcattgcctatg
agtgtggacgaaattcaaagttacgggctgccgttccaaaaggacttcatgaccaaaccg
ttcatcaatgaagagatgctaaacaagatgtttggtgacaaagctgcctttgtaaaagaa
acattcgtacagcatgctcacgatgacatttatgaaatgcgcccggaatatgatacccaa
cgcaaagtggaggcttatttctccgataagaaagatgaagaaagtatccatatacgcgag
ggagtatatgccttgataagcaatgtattatttgttcccgaccgcaagcacccctccatg
tatcatccaagaattgccgttcagaatgatttcatcttcgggcgcctcgactggaaggag
aaagatgctttcaaccgtctgtataatcattattattaccaacgccataaccagttctgg
tatcaggaagcgatgaaaaagctgcctatcctgacacaagccacttctatgctggtgtgc
ggagaggatttaggaatggttcccgactgtgtgccttgggtaatggaccagttgcaaata
ctcagcctggaaatccaacgtatgcccaagaatcccaaacacgagttcggtcacgtgtgg
gaatatccgtaccgctcggtctgtactatttccactcatgacatgtctactctgcgggga
tggtgggaagaagattacgaacagacctgccgctactacaaccatgtaatgggacactgg
ggagaagttccggtttcagccccgggatgggtttgcgaggaaatagtacgccaccatctg
gaatgtccgtcattgctgtgcatcctgtcctttcaggactggctgtcaatagacgaagaa
atccgctatcccgatgtgaacgcggaacgtatcaacgtacctgccaatccaagacattac
tggagatatcgtatgcatctcactttggaagaactgataaagaacaagaagttcaatgaa
aagctggtagagatgattgacaccaccggcagattctaa

DBGET integrated database retrieval system