KEGG   Bacteroides vulgatus: BVU_1713Help
Entry
BVU_1713          CDS       T00546                                 

Definition
(GenBank) glycerophosphoryl diester phosphodiesterase
  KO
K01126  glycerophosphoryl diester phosphodiesterase [EC:3.1.4.46]
Organism
bvu  Bacteroides vulgatus
Pathway
bvu00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bvu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BVU_1713
Enzymes [BR:bvu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.46  glycerophosphodiester phosphodiesterase
     BVU_1713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4996 GDPD PI-PLC-X
Motif
Other DBs
NCBI-ProteinID: ABR39389
UniProt: A6L125
Position
2207498..2208433
Genome map
AA seq 311 aa AA seqDB search
MKRLIIFTAVFGLCTFASAQTLTKLEVFRSKGCGDYVWVASHRADGVFAPENSLLALQHA
IQLGCDIVETDVHLTKDGNIVIMHDHSVDRTTNGEGKIADLTLKEIKELNLRDNWGASTE
CKVPTLEEYIQVAKGKIFLYLDKAGYDLPGHESGYMVKKLLHVLERTQALEQTIFVLDWP
YEKAKRIFGDCLEKVIFCPVVDDRIPDLEQYVDEYIDKLSPVAFQFRFKDCNTTTYSLIP
KVQASGSKLFVAATWNNHTAEHSDYVSVFSRPSEGWGWLIDKGFRVIETNFARDLIRYLN
VENRRIFPSDD
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaagagattgatcatatttactgctgtgtttggtttgtgtacctttgcttcagcacaa
acgcttacaaagctagaagtcttccgttctaaaggatgcggagactatgtttgggtagct
tcacatcgggctgacggtgtgttcgctccagaaaattctctactggcccttcaacatgct
atacaattgggttgtgatattgtcgaaaccgatgttcatttgaccaaagacggcaacata
gtcattatgcatgatcattccgttgatagaacgaccaatggagagggtaagatagcagat
cttacattaaaagaaatcaaggaattgaacctacgtgacaactggggggcatccactgag
tgcaaggtacctaccctcgaagaatacatccaggtagctaagggtaaaatcttcttgtac
ttggacaaggctggatacgatttgcctggccatgaatcaggatacatggttaagaaactg
cttcatgtattggagcgcacccaggctttggaacagacgatctttgtacttgactggccc
tatgaaaaagccaagcggatttttggggattgtctggagaaagtaatcttttgccctgtc
gttgatgaccggatacctgatcttgaacaatacgtagatgaatatatcgacaagctatca
ccggttgcctttcagttccgatttaaagattgtaacacgacgacttattcgcttatccct
aaagtacaggcctcaggcagcaaactgttcgtagctgctacgtggaacaaccatactgca
gaacatagcgattatgtatccgtgttttctcgtccgtcagaagggtgggggtggctcatt
gacaaggggttcagagtaatcgaaactaattttgctcgcgacctgattcgctatctcaac
gtagaaaacaggcgtatatttccatcggatgattag

DBGET integrated database retrieval system