KEGG   Bacteroides vulgatus: BVU_1713Help
Entry
BVU_1713          CDS       T00546                                 

Definition
glycerophosphoryl diester phosphodiesterase
Orthology
K01126  
glycerophosphoryl diester phosphodiesterase [EC:3.1.4.46]
Organism
bvu  Bacteroides vulgatus
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:bvu00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2207498..2208433
Genome map
AA seq 311 aa AA seqDB search
MKRLIIFTAVFGLCTFASAQTLTKLEVFRSKGCGDYVWVASHRADGVFAPENSLLALQHA
IQLGCDIVETDVHLTKDGNIVIMHDHSVDRTTNGEGKIADLTLKEIKELNLRDNWGASTE
CKVPTLEEYIQVAKGKIFLYLDKAGYDLPGHESGYMVKKLLHVLERTQALEQTIFVLDWP
YEKAKRIFGDCLEKVIFCPVVDDRIPDLEQYVDEYIDKLSPVAFQFRFKDCNTTTYSLIP
KVQASGSKLFVAATWNNHTAEHSDYVSVFSRPSEGWGWLIDKGFRVIETNFARDLIRYLN
VENRRIFPSDD
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaagagattgatcatatttactgctgtgtttggtttgtgtacctttgcttcagcacaa
acgcttacaaagctagaagtcttccgttctaaaggatgcggagactatgtttgggtagct
tcacatcgggctgacggtgtgttcgctccagaaaattctctactggcccttcaacatgct
atacaattgggttgtgatattgtcgaaaccgatgttcatttgaccaaagacggcaacata
gtcattatgcatgatcattccgttgatagaacgaccaatggagagggtaagatagcagat
cttacattaaaagaaatcaaggaattgaacctacgtgacaactggggggcatccactgag
tgcaaggtacctaccctcgaagaatacatccaggtagctaagggtaaaatcttcttgtac
ttggacaaggctggatacgatttgcctggccatgaatcaggatacatggttaagaaactg
cttcatgtattggagcgcacccaggctttggaacagacgatctttgtacttgactggccc
tatgaaaaagccaagcggatttttggggattgtctggagaaagtaatcttttgccctgtc
gttgatgaccggatacctgatcttgaacaatacgtagatgaatatatcgacaagctatca
ccggttgcctttcagttccgatttaaagattgtaacacgacgacttattcgcttatccct
aaagtacaggcctcaggcagcaaactgttcgtagctgctacgtggaacaaccatactgca
gaacatagcgattatgtatccgtgttttctcgtccgtcagaagggtgggggtggctcatt
gacaaggggttcagagtaatcgaaactaattttgctcgcgacctgattcgctatctcaac
gtagaaaacaggcgtatatttccatcggatgattag

DBGET integrated database retrieval system