KEGG   Bacteroides vulgatus: BVU_1815Help
Entry
BVU_1815          CDS       T00546                                 

Definition
carbohydrate esterase family 8 protein
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
bvu  Bacteroides vulgatus
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bvu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BVU_1815
   00500 Starch and sucrose metabolism
    BVU_1815
Enzymes [BR:bvu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     BVU_1815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2352154..2353878
Genome map
AA seq 574 aa AA seqDB search
MKIKMLMAFVALLFSAFTADRTITIFMIGDSTMANKPLEGGNQERGWGHVLGGYFSENIR
VENHARNGRSSKSFIDEGLWEVVINKVKPGDYVFIQFGHNDEKADEKRHTDPGSTFDANL
RRFVKETRAKGGIPVLFNAIVRRNFRNNKNAVAEDDVRKDLSKGSVSQDGEVLIDTHGKY
LESPRNVAKELDVPFVDMNKITHDLVQEMGPEASKKLFMWIPEGVCAACPKGREDNTHLN
VYGARTIAGLTVDAIAKEVPALAPFVRHYDFVVAKDGSGDFFTIQEAIHAVPDFRKAGRT
TILVRKGVYKEKVVIPESKISVSLIGEDGAILTNDDFAAKKNYFGEEMSTSGSSTCYIYA
PDFYAENITFENSAGRVGQAVACFVSGDRAYFKNCRFLGNQDTLYTYGKDSRQFYDHCYI
EGTVDFIFGWSTALFKDCTIHSLGDGYVTAPSTDQGKKYGYVFIGCKLTGVAEAQKVYLS
RPWRPYAQAVYIHCDLGKHILPVGWNNWGKKENEETVFYAEYRNTGEGAATASRASFGKQ
LNDISNYNEAQILAGDDGWNPVENGNVLLQNLKR
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaagatgttgatggcatttgttgccttgttgttttctgcttttacggcagac
cgcacaattactatctttatgataggtgactcgactatggctaacaaacccttagaggga
ggtaatcaggaacgtggatggggccatgtgctgggaggatatttcagtgagaatattcgt
gtggaaaaccatgctagaaatggtcggagttctaaaagttttattgatgaaggattgtgg
gaggtagtaattaataaagtaaagccgggtgattatgtttttattcagtttgggcataat
gatgagaaggccgatgagaaacgtcatactgatcccggatctacttttgatgccaatcta
cgccgttttgtaaaagaaacacgtgctaaagggggaattcccgtgttgtttaatgccatt
gtccgtcgtaatttccggaataataaaaatgcggtagccgaagatgatgtgcgcaaggat
ttgtcaaaggggagtgtttctcaagatggagaagtgttgattgatactcatggaaaatat
ttggagtctccgcgtaacgtggcaaaagagttggatgtgccttttgtggatatgaacaag
ataacgcatgatttggtgcaggagatgggaccggaggcttcaaaaaaattgttcatgtgg
attcctgaaggtgtgtgtgcagcttgtccgaaagggcgtgaggataatacgcacctgaat
gtatatggggcgcgtactattgctggtttgacggtggatgctatagctaaagaggttcct
gcattggcgccttttgtacgtcattatgattttgtagtggcaaaagatggcagtggtgat
ttctttaccattcaggaagcgattcatgctgtccccgattttcgtaaagcaggacgcact
actattctagtccgtaaaggggtatataaagaaaaagtggttattcctgaaagcaagatt
agtgtttctttgataggtgaggacggagcaattctgacaaatgatgattttgctgctaaa
aagaactatttcggagaagaaatgtctacctccggttcatcaacctgttatatctatgct
cccgatttctatgctgagaatatcactttcgagaatagtgccggcagagtggggcaggca
gtggcctgttttgttagtggagatcgcgcttatttcaaaaactgtcgttttttgggaaat
caggatactttgtacacttatggcaaagacagtcgtcagttttatgaccattgttatata
gagggtacagtggattttatttttggctggtctacggcattgtttaaggattgcaccatc
catagtttgggtgatgggtatgttaccgctccttctacagatcaaggcaaaaaatatggc
tatgtttttataggctgtaaattgacgggtgtggctgaggctcagaaggtgtatttgtcc
cgtccttggcgtccttatgcacaggctgtttatattcattgtgatttgggaaagcatatt
cttccggtgggttggaacaactggggcaaaaaagaaaatgaggaaaccgtattctatgct
gaataccggaatacgggagaaggggcggctaccgcttcgcgtgcttcgtttggaaagcag
ctgaacgatatcagtaattataatgaagcacagattttggcaggtgatgacggatggaat
ccggtggaaaatggaaatgtgttgttgcagaatttaaagagataa

DBGET integrated database retrieval system