KEGG   Bacteroides vulgatus: BVU_1895Help
Entry
BVU_1895          CDS       T00546                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bvu  Bacteroides vulgatus
Pathway
bvu00010  Glycolysis / Gluconeogenesis
bvu00260  Glycine, serine and threonine metabolism
bvu00680  Methane metabolism
bvu01100  Metabolic pathways
bvu01110  Biosynthesis of secondary metabolites
bvu01120  Microbial metabolism in diverse environments
bvu01130  Biosynthesis of antibiotics
bvu01200  Carbon metabolism
bvu01230  Biosynthesis of amino acids
Module
bvu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bvu_M00002  Glycolysis, core module involving three-carbon compounds
bvu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bvu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BVU_1895
  Energy metabolism
   00680 Methane metabolism
    BVU_1895
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BVU_1895
Enzymes [BR:bvu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BVU_1895
Membrane trafficking [BR:bvu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BVU_1895
Exosome [BR:bvu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BVU_1895
  Exosomal proteins of melanoma cells
   BVU_1895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABR39570
UniProt: A6L1K6
Position
complement(2468117..2468878)
Genome map
AA seq 253 aa AA seqDB search
MKRIVLLRHGESTWNKDNRFTGWTDVDLTEKGIADANQAGILLKEKGFHFDKAYTSFLKR
AVKTLNCVLDKMDQDWIPVEKSWRLNEKHYGALQGLNKSETASKYGEEQVLIWRRSFNVA
PNALPEDDPRNPKTDTRYKEVPDKDLPRTESLKETVERILPYWKCIIFPNLATANELLVV
AHGNSLRGIIKYLKHIPDEEIVGLNLPTAVPYVFEFDNDLNLKKDYFLGDPEKIKKLMEA
VADQGKTNPGGRK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaatcgtattactccgccatggagaaagtacttggaacaaagacaaccgtttt
acaggatggacagatgtagatttaaccgaaaaaggtatcgctgatgccaaccaagcaggt
atactcttaaaagaaaaaggatttcattttgataaagcttacacttcttttttaaagcgt
gcggtcaaaacattaaactgtgtcctagataaaatggatcaagactggatacctgtagag
aaaagttggcgcctaaatgagaaacattatggcgcattgcaaggattaaacaaaagcgaa
acagcttctaaatacggagaagaacaagtcttgatatggcgccgtagttttaacgtagcc
cccaatgccctaccggaagatgatccgcgcaatccgaaaacagatacccgttataaagaa
gttcctgacaaagatcttccacgtaccgaatctctgaaagaaacagtagaacgtatatta
ccttattggaaatgcatcatcttccccaatctagctacagcaaacgaactgctggtagta
gctcacggaaacagcctcagaggaattattaaatatttgaaacatataccggatgaggaa
attgtaggtcttaatctacctactgctgttccgtatgtattcgagtttgataatgacctg
aatttgaagaaagactactttttgggagatccggaaaaaataaaaaaactaatggaagct
gtagccgatcaaggaaaaaccaaccccggtggcaggaaataa

DBGET integrated database retrieval system