KEGG   Bacteroides vulgatus: BVU_1895Help
Entry
BVU_1895          CDS       T00546                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bvu  Bacteroides vulgatus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bvu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BVU_1895 (gpmA)
   01230 Biosynthesis of amino acids
    BVU_1895 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BVU_1895 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    BVU_1895 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BVU_1895 (gpmA)
Enzymes [BR:bvu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BVU_1895 (gpmA)
Exosome [BR:bvu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BVU_1895 (gpmA)
  Exosomal proteins of melanoma cells
   BVU_1895 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2468117..2468878)
Genome map
AA seq 253 aa AA seqDB search
MKRIVLLRHGESTWNKDNRFTGWTDVDLTEKGIADANQAGILLKEKGFHFDKAYTSFLKR
AVKTLNCVLDKMDQDWIPVEKSWRLNEKHYGALQGLNKSETASKYGEEQVLIWRRSFNVA
PNALPEDDPRNPKTDTRYKEVPDKDLPRTESLKETVERILPYWKCIIFPNLATANELLVV
AHGNSLRGIIKYLKHIPDEEIVGLNLPTAVPYVFEFDNDLNLKKDYFLGDPEKIKKLMEA
VADQGKTNPGGRK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaatcgtattactccgccatggagaaagtacttggaacaaagacaaccgtttt
acaggatggacagatgtagatttaaccgaaaaaggtatcgctgatgccaaccaagcaggt
atactcttaaaagaaaaaggatttcattttgataaagcttacacttcttttttaaagcgt
gcggtcaaaacattaaactgtgtcctagataaaatggatcaagactggatacctgtagag
aaaagttggcgcctaaatgagaaacattatggcgcattgcaaggattaaacaaaagcgaa
acagcttctaaatacggagaagaacaagtcttgatatggcgccgtagttttaacgtagcc
cccaatgccctaccggaagatgatccgcgcaatccgaaaacagatacccgttataaagaa
gttcctgacaaagatcttccacgtaccgaatctctgaaagaaacagtagaacgtatatta
ccttattggaaatgcatcatcttccccaatctagctacagcaaacgaactgctggtagta
gctcacggaaacagcctcagaggaattattaaatatttgaaacatataccggatgaggaa
attgtaggtcttaatctacctactgctgttccgtatgtattcgagtttgataatgacctg
aatttgaagaaagactactttttgggagatccggaaaaaataaaaaaactaatggaagct
gtagccgatcaaggaaaaaccaaccccggtggcaggaaataa

DBGET integrated database retrieval system